HOG Organism Gene ID Name Annotation
aHOG1610 hbo HBOR02720 Hbor_02720 hypothetical protein
aHOG1610 hla HLAC2716 Hlac_2716 hypothetical protein
aHOG1610 hwa HQ1030 hypothetical protein
aHOG1610 nph NP1824 hypothetical protein
aHOG1610 hma Hma_12597 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


1824|hp|nph       ---------------------MSQGESND---------AEKDSGSLKEGLSESAGDPRVH
2716|hp|hla       ------------------MGEDQKGTSED-------------PKGIREGVEGSKGDLRVV
1030|hp|hwa       -----------------------METRSD-------------------------GDPRVL
12597|hp|hma      MRRVRLRMCLVARLGRARPENEAPGTAKELRGVPSVFVGMSDANGFEEGASGSQGDPRVL
2720|hp|hbo       -----------------------MGTNPT-----------------------SSGDPRVL
                                                                        ** ** 

1824|hp|nph       LVMNLLLSAMFVYTLLWGLDFLGTLEFTRLRFAFGTVVMMGLTRTLI--
2716|hp|hla       LLLNAVLSGMFAWTAFWGLQLLDVAEVTATNVASLALIVFALTYVTVLR
1030|hp|hwa       FAMNIILSAVFGTGIIWGLSFIEIATFSPINVVTLTLIIAAVTYAIVM-
12597|hp|hma      IAMNVVLSTVFSATLVWGLSVIGAAELTAINVATGAILLFALTYAITLQ
2720|hp|hbo       FVMNLVLSSVFAAVVVWGLDFIGMVELTFVNVASLALVLMAVTYLVTR-
                  : :* :** :*    .***..:    .:  ...  :::: .:*