HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0161COG1599KOG0851arCOG01510Single-stranded DNA-binding replication protein A (RPA) large (70 kD) subunit and related ssDNA-binding proteinsreplication A related protein

HOG Organism Gene ID Name Annotation
cHOG0161 nrc1 VNG0133 rfa1 replication A related protein
cHOG0161 hmu HMUK0565 Hmuk_0565 nucleic acid binding OB-fold tRNA/helicase-type
cHOG0161 hma RRNAC2302 rpa replication factor A
cHOG0161 hwa HQ1435A rpa replication factor A
cHOG0161 hla HLAC0111 Hlac_111 nucleic acid binding OB-fold tRNA/helicase-type
cHOG0161 hbo HBOR26830 Hbor_26830 single-stranded DNA-binding protein
cHOG0161 hut HUTA2247 Huta_2247 nucleic acid binding OB-fold tRNA/helicase-type
cHOG0161 hvo HVO_0519 HVO_0519 rpa replication A related protein
cHOG0161 nph NP0314A rpa replication factor A
cHOG0161 hhi 2754 rpaA3 replication factor A
MUSCLE (3.6) multiple sequence alignment


2247|gene|hut       MGAIEDVYADLDADVSEDDFREAVEEKVEQMGGLADEETAAMLIAHELTENEAQTVADVQ
12302|gene|hma      MGAIEDIYEDLETDVPEEEFREAVEEKVEQMGGLADEETAAMLLAHELNENEVNAIADIE
2754|gene|hhi       MGAIEDIYEDLETDVPEEEFREAVEEKVEQMGGLADEETAAMLLAHELNENEVNAIADIE
133|gene|nrc1       MGAIEDVYADLDTDVSIEEFREAVESKVEQMGGLADEETAAMLIAHEIDDGEVNGVADID
314|gene|nph        MGAIEDIYEDLDADVSESEFREAVEAKVEQMGGLADEETAAMLIAHDLDGGEVETIADIE
1435|gene|hwa       MSSLTDIYDELDTDVSREEFESAVEDKVEQMGGLADEETAAKLIAHELRNEEVEGVADIE
111|gene|hla        MGVIEDVYEDLDTDVEFEEFEAAVEDKVEQMGGLADEETAAMLIAHELRDEEADTIADIE
26830|gene|hbo      MGAIEDVYDDLDTDVPFEEFEAAVNDKVEQMGGLADEETAAMLIAHELRDEEVEGIADIE
                    *. : *:* :*::**  .:*  **: *************** *:**::   *.: :**::

2247|gene|hut       AGMEEVRFLAKVLSIGELRTFERDGDD-ED-----GRVINVEAADETDSLRLTFWDGEAV
12302|gene|hma      PGMDEVKFLAKVMAIGDLKTFERDDED-ED-----GRVINVEAADESGSLRLAFWDGQAV
2754|gene|hhi       PGMDEVKFLAKVMAIGDLKTFERDDED-ED-----GRVINVEAADESGSLRLAFWDGQAV
133|gene|nrc1       SEMDEVKFIAKVTRVGDVRTFDREDAD-DDDAAAEGRVVNVTVADETDDVRVSLWDEQAT
314|gene|nph        PGLEEVKFLGKVASVGELRTFERDGEDDED-----GHVLNLDVADESGTVRVALWDDDAV
1435|gene|hwa       PGMDEAKFLAKVLQIGDCRTFERDGDA-ED-----GRVINIEVADASGQIRVTMWDDMAD
111|gene|hla        PGMNDVKFLGKVTSIGDIRTFERDDEDAEE-----GRVCNVDVADASGSVRVALWDDMAA
26830|gene|hbo      PGMDDVKFLGKVMSIGELRTFERDDED-ED-----GRVVNVEVADETGRIRISLWDGMAE
                    . :::..*:.**  :*: .**:*:.   ::     *.* *: .** :. :*:::**  * 

2247|gene|hut       AVDEGEVEVGDVLRVKGRPQEGYNGLEVSVDQAEQDLDATIDVEPG--DGETIDALTMGQ
12302|gene|hma      DIDEGKLEVGDVLRVKGRPKDGYNGLEVSVDKAEPDEDATIDVEPG--AGSSIDALTMGQ
2754|gene|hhi       DIDEGQLEVGDVLRVKGRPKDGYNGLEVSVDKAEPDDDATIDVEPG--AGSSIDALTMGQ
133|gene|nrc1       AAAD-DLAPGDVLRIKGRPTDGYNGLEVSADEVELDADEQIDVQIQ--DEYDAADLSLGV
314|gene|nph        AADE-EVEPGQVFRIKGRPKDGYSGVEVSADRIEADEEAEIEVDLD--GRTTADSLSMGQ
1435|gene|hwa       DAID-QLEVGQVLRIGGRPKDGYDDVEIDVDTVEPAPDAEIDVDIHTVNTHRVEDLSLGL
111|gene|hla        AAEE-QLEVGQVLRVMGRPKEGYSGLEVSADKVEPDEDAEVDVQVL--DTYRVEDLSLGA
26830|gene|hbo      EATE-NLEVGQVLRIAGRPKDGYNGVEVSVNKVEPDADAEIDVQTQ--DSYRVEDLSLGL
                       : .:  *:*:*: *** :**..:*:..:  *   :  ::*:           *::* 

2247|gene|hut       SNVTVEGVVLDTEPVRTFERDDGSEGRVANLSIGDETGRVRVTLWDDRADRVEEIDAGTT
12302|gene|hma      SDVTLRGLVLDTDSIRTFDRDDGSEGRVSNLTLGDETGRIRVTLWDDRADRADELDAGAA
2754|gene|hhi       SDVTLRGLVLDTDTIRTFDRDDGSEGRVSNLTLGDETGRIRVTLWDDRADRAEELDAGAA
133|gene|nrc1       SDVTLVGEVLDTEAVRTFDRDDGSEGRVSNLVVGDETGRVRVTLWDDQADTATDLDAGAV
314|gene|nph        SDVTLRGVVLDTDAVRTFDRDDGSEGRVSNLTLGDETGKIRVTLWDEQADRAEALEAGQS
1435|gene|hwa       SDVNLRGRVLSTDKIRTFDRDDGSEGRVANLSVGDPTGRIRVTLWDGSASLVDSVDPDDS
111|gene|hla        SDVDLVGQVLDTDSIRTFDRDDGSEGRVANLTVGDETGRVRVTLWDDKADLVEEFEAGEV
26830|gene|hbo      SDVNLKGRVLSTDSVRTFDRDDGSEGRVANLTLGDSTGRIRVTLWDDKADLAAEFDTDIT
                    *:* : * **.*: :***:*********:** :** **.:******  *. .  .:..  

2247|gene|hut       VEVVDGYVRERDGDLEVHVGEEGAIDELDDADVEYAPETTPIDDVELDETVDIGGVVRST
12302|gene|hma      VEIIDGYVRERDGSLELHVGDQGAVDEV-EDDVAFEPDADPIAEVELEETADIAGVVRSA
2754|gene|hhi       VEIIDGYVRERDGSLELHVGDQGAVDEV-DDDVAFEPDADPIAEVELEETADIAGVVRSA
133|gene|nrc1       VEIVDGYVREREGSLELHVGDTGAVTPVPDADVSFVPDTTSIDSLEQDDTADIAGVVRSV
314|gene|nph        VEIVDGYVREREGDLELHAGSRSDIDEL-DESVEFVPDATDIDSIAIDETVDIAGVVRSA
1435|gene|hwa       IEIVDGYVREQDGALELHVGDRGTIESI-DEDVEYVPDTDPIETVVIDETADIAGGVIET
111|gene|hla        VEVGDGYVRERDGDLELHVGDRGTVERV-DEDVEYVPETTDIAELEIGETVDIGGGVIET
26830|gene|hbo      VEVVDGYVRERDGSLELHVGNRGTLEEI-DENVEYVPETADIASLELGQTVDIAGGVIET
                    :*: ******.:* **:*.*. . :  : : .* : *::  *  :   :*.**.* * ..

2247|gene|hut       DPTRTFDRDDGSEGQVKNIRIQDDTDDIRVALWGEKADRDLAPGDEVVCADVEIQDGWQD
12302|gene|hma      DPKRTFDRDDGSEGQVRNVRIQDATGDIRVALWGDKADKDIAPGDEVLAADVEIQDGWQD
2754|gene|hhi       DPKRTFDRDDGSEGQVRNVRIQDATGDIRVALWGDKADKDIAPGDEVLAADVEIQDGWQD
133|gene|nrc1       DPTRTFDRDDGSEGQVRNVRLQDDTGDIRVALWGEKADLDIGPGDEVAALDVEIQDGWQD
314|gene|nph        DPKRTFDRDDGSEGQVRNVRLQDNTGDIRVALWGEKADLDVGPGDEVFCADVEIQDGWQD
1435|gene|hwa       DTKRTFDRDDGSKGQVRNVRIRDDTGDIRVALWGDKADLDIDLADYVVCTDVEIQEGWQD
111|gene|hla        DPKRTFDRDDGSEGQVRNVRIKDDTGEIRVALWGDKADREIELADRVVFTDVEVQDGWQD
26830|gene|hbo      DPKRTFDRDDGSEGQVRNIRVKDDTGDIRVALWGEKADTDVDLADYVVITDAEIKEGWQE
                    *..*********:***.*:*:.* *.:*******:*** ::  .* *   *.*:::***:

2247|gene|hut       DLEASAGWGSTVVVLEDGASMATTPDADDAGTAGENNVQDAGA-STGLSAFAD-------
12302|gene|hma      DKEASASWNSTIVVLDDGADLAT------GGAGGGASAETTDAEHAGLSSFGD-------
2754|gene|hhi       DKEASASWNSTVVVLDDGADLAT------GGAGGGASAETTDAEHAGLSSFGD-------
133|gene|nrc1       DIEASAGWQASVIPLSDSTQ--------------DDAAAGSDGPDRGLAAFGA-------
314|gene|nph        DLEASAGWQSTVVVLDD-------------------DDPDRGGDSAGLDEFSG-------
1435|gene|hwa       DHEASAGWRSAVYRLDERPEDATT-----TVESSSDQQQTETGKASGLDAFAETNSDETT
111|gene|hla        DLEASANWRSTVTVLDEGSDAVGGASGS-GSAGSSDDGDAHGTNNTGLGAFAG-------
26830|gene|hbo      DLEASAGWRSTITVMDESPAGAA------GTDADADAGTSADSQAQGLGAFED-------
                    * ****.* :::  :.:                             **  *         

2247|gene|hut       -----DGEGGETASDGTGGSTAGAEDGTAD--------GEE-------------VEFTGT
12302|gene|hma      -----EGDDTDADSSGNEAAAVSAGTGDTSPDGGAQSAGQQ-------------VEFTGT
2754|gene|hhi       -----GADDADTDNSGDGAAAVSAGTGDTSPDGGAQSAGQQ-------------VEFTGT
133|gene|nrc1       ------------DSDDEPAATDDAADTQTPHS------DTP-------------VEFTGV
314|gene|nph        -----GSAAAHDGSDGSDPAADDEAASDAG--------DEP-------------ETVTGT
1435|gene|hwa       VTASPTSQDSNITSSDSMRDNADHNHEQAASDGGASTIESPQTSEDDNTTDSDVESFTGT
111|gene|hla        -DEQKAAAEAVAGETGGDGGNSGVGGGNGGSGGAATATAEQSAEE---------IEFTGT
26830|gene|hbo      ----GASADSNSSAAGSEQSSGSASEADDPAD------GSV-------------EEFTGT
                                   .      .                                 .**.

2247|gene|hut       VVQTGDPVIVDDGEQTVTVDTTESVRLGEEVTVRGRRRGDEIEAEELF----
12302|gene|hma      VVQTGDPVVLDDGEQTMSVETGERVQLGQEITVRGELRDDRLHAEDVF----
2754|gene|hhi       VVQTGDPVVLDDGEQTMSVETGERVQLGQEITVRGELHDDRLHAEDVF----
133|gene|nrc1       VVQAQDPLILDDGEETMSVTTDADVTLGQEVTVRGSLDDGRLHADDVTES--
314|gene|nph        VVQPADPVILDNGDETIHVETDAEVHLGQEVTVRGRRDGERFVAEDVF----
1435|gene|hwa       VVQAGSPVVLDNGTDTRRVETDASLRLGEVVTVTGSTDGQTITPTEIDRSS-
111|gene|hla        VVQTGDPVVLDDGQRTKSVETDASLRLGEEVTVRGTERDGTIDADDVF----
26830|gene|hbo      VVQAGNPVVLDNGTETRSVETSESLQLGAEVTVRGPVRDGRIEATDVQSVTR
                    ***. .*:::*:*  *  * *   : **  :** *   .  : . ::