HOG Organism Gene ID Name Annotation
aHOG1601 hhi 1183 galE6 UDP-glucose 4-epimerase
aHOG1601 hbo HBOR16500 Hbor_16500 nucleoside-diphosphate-sugar epimerase( EC:5.1.3.2 )
aHOG1601 hbo HBOR31640 Hbor_31640 nucleoside-diphosphate-sugar epimerase( EC:5.1.3.2 )
aHOG1601 hla HLAC1104 Hlac_1104 NAD-dependent epimerase/dehydratase
aHOG1601 hwa HQ2650 galE nucleoside-diphosphate-sugar epimerase ( UDP-glucose 4-epimerase)
aHOG1601 nph NP3504 galE_3 nucleoside-diphosphate-sugar epimerase 3 ( UDP-glucose 4-epimerase )
aHOG1601 hma Hma_10452 galE UDP-glucose 4-epimerase
MUSCLE (3.6) multiple sequence alignment


3504|gene|nph       MDGQRVLVTGGAGFIGSTLANRLSVTNDVVVVDDCYLGTPENLESAVTFNERSVLDDDLP
1104|gene|hla       MHDQRVLVTGGAGFIGSNLANRLAADNDVIAVDDTYLGTPENLDDNVEFVEADVIDDDFP
1183|gene|hhi       MESQRVLVTGGGGFIGANLANKLAENNDVVALDDGYLGTPENVSDDVEYVEQSVLADDLP
10452|gene|hma      MENQRVLVTGGGGFIGANLANKLAENNDVVALDDGYLGTPENVSEDVEYVEQSVLDDDLP
31640|gene|hbo      MQGKQVLVTGGAGFIGSNLANALAPDNDVIAIDDCYLGTPENLDSGVEFVDASVLDEDLP
16500|gene|hbo      MHDKRVLVTGGAGFIGSNLANHLADSNEVIAVDDLHLGTPENLSSAVEFVDASVLDDDLP
2650|gene|hwa       MHENRVLVTGGAGFIGSNLANHLAETNEVIAVDDLHLGTPSNLDETVEFVNASVLEDDLP
                    *  :.******.****:.*** *:  *:*:.:** :****.*:.. * : : .*: :*:*

3504|gene|nph       T-DVDVVFHCAALSSYPMHESDPTRGARVNVEGFVNVVEQARADGCDTVVYASSSSVYGS
1104|gene|hla       A-DVDVLFHLAALSSRNMHENDPQRGCRVNVEGFVNAVERARQEGCETVVYASTSSIYGN
1183|gene|hhi       T-DVDVVFHLAALSSYAMHEDNPTHGARVNVEGFVNTVEQARDDGCDTIVYASTSSIYGS
10452|gene|hma      T-DVDVVFHLAALSSYAMHEDNPTHGARVNVEGFVNTVEQARDDGCDTIVYASTSSIYGS
31640|gene|hbo      T-DVDVVFHLAALSSYQMHEQDPTTGARVNVEGFVNTVEQARKDGCETVVYASTSSIYGS
16500|gene|hbo      TEGIDVLFHLAAYSSYTMAEENKRAATRVNVEGFVNAVEQAREDGCETVVYASTSSIYGS
2650|gene|hwa       TADIDVVFHLAAYSSYTMVEENKQTATRVNVEGFVNTVEQAREDGCQTVVYASTSSIYGS
                    : .:**:** ** **  * *.:   . *********.**.** :**:*:****:**:**.

3504|gene|nph       RSEPTTEAAPVAANSGYEASKLARERYAEYFSHHYGLSLAGMRLFSVYQGYGAAEGHKGE
1104|gene|hla       RTEPSPVDMDVEARTAYEASKLARERYAEYYGNYHDMAMAGLRFFSVYQGFGGNEKHKGE
1183|gene|hhi       RTEPSPEDMDVTVNTGYEASKMARETYAEYFQNHYDLTLAGMRFFSVYQGYGGAEEHKGE
10452|gene|hma      RTEPSPEDMDVTVNTGYEASKMARETYAEYFQNHYDLTLAGMRFFSVYQGYGGAEEHKGE
31640|gene|hbo      RTEPSPESMAIEARTGYEASKLAREQYAEYFYNHYDLTLAGMRFFSVYQGFGGAEEHKGE
16500|gene|hbo      RTEPSPEDMPVEARTCYEASKLAREQYGEYFHHHYDMTLAGLRFFSVYQGYGGAEEHKGE
2650|gene|hwa       RTNPSPEDLPVEARTCYEASKLARETYAEYFNNHYDMTLAGLRFFSVYQGYGGAEEHKGE
                    *::*:.    : ..: *****:*** *.**: :::.:::**:*:******:*. * ****

3504|gene|nph       YANLVAQFVDDIATGERPAIYGDGTQTRDFIHVEDVVAALCSAAEAALDGVYNVGTGDRY
1104|gene|hla       YANTVAQFADAIANGEAPELFGDGSQTRDFTHVSDVARACELAADHELTGVYNVGTEEAY
1183|gene|hhi       YANVIAQFADDLAGGDAPKLYGDGEQTRDFTHVDDIVRGLVLAAEHELNGVYNLGTGEAY
10452|gene|hma      YANVIAQFADDLASGDAPKLYGNGEQTRDFTHVDDIVRGLVLAAEHELNDVYNLGTGEAY
31640|gene|hbo      YANTVAQFTEKIANGEQPELFGDGSQTRDFTHVDDIVRGLVLAAEHELNGVYNLGTGESY
16500|gene|hbo      YANTVAQFAHKIANGERPELFGDGSQTRDFTHVNDIVRGIELAADHRLQGIYNLGTGESY
2650|gene|hwa       YANTVAQFAEKIANGERPALFGDGTQTRDFTHVDDIVRGIEDAAEYELQGIYNLGTGESY
                    *** :***.  :* *: * ::*:* ***** **.*:. .   **:  * .:**:** : *

3504|gene|nph       SLNDLVDKINETVGADIRPKYVENPIPEDVYVTDTCADCSKLRSETNWEPTVGFDEGVKR
1104|gene|hla       SFNEMVAMINDALGTDIDPVYIECPF--DGYVHDTMADYSTFHEATGWEPEIGFEEGVEL
1183|gene|hhi       DFNTVVEMLNDELGTDIEPEYVENPIPEDVYVHDTCADFSRMHDATGWEPEISFEEGIEL
10452|gene|hma      DFNTVVEMLNDELGTDIEPEYIENPIPEDVYVHDTCADFSKMHEATGWEPETSFEEGIEL
31640|gene|hbo      SFNEMVAMINEVLGTDVEPKYIENPL--DEYVHDTMADPTKMKEATGWEPEISFEEGVQR
16500|gene|hbo      DFNTMVRLINEELGTDVEPKYIENPL--DVYVHDTMADTTKIREATGWEPKISFEEGVQR
2650|gene|hwa       DFNTMVEMINDELGTDIDPKYIENPL--EVYVHDTMADSTKIREATEWTPKITFEEGVSR
                    .:* :*  :*: :*:*: * *:* *:  : ** ** ** : :.. * * *   *:**:. 

3504|gene|nph       VCEQYR-------
1104|gene|hla       VCEPYSERAPEEV
1183|gene|hhi       VCAPYT-------
10452|gene|hma      VCAPYT-------
31640|gene|hbo      VCEPYLDE-----
16500|gene|hbo      VCEPYLDD-----
2650|gene|hwa       VCEPYMN------
                    **  *