HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0160COG0016KOG2784arCOG00410Phenylalanyl-tRNA synthetase alpha subunitphenylalanyl-tRNA synthetase subunit alpha

HOG Organism Gene ID Name Annotation
cHOG0160 nrc1 VNG2504 pheS phenylalanyl-tRNA synthetase subunit alpha
cHOG0160 hmu HMUK0664 Hmuk_0664 phenylalanyl-tRNA synthetase, alpha subunit( EC:6.1.1.20 )
cHOG0160 hma RRNAC2966 pheS phenylalanyl-tRNA synthetase subunit alpha
cHOG0160 hwa HQ1049A pheS phenylalanyl-tRNA synthetase subunit alpha
cHOG0160 hla HLAC2671 Hlac_2671 phenylalanyl-tRNA synthetase, alpha subunit
cHOG0160 hbo HBOR03090 Hbor_03090 phenylalanyl-tRNA synthetase, alpha subunit( EC:6.1.1.20 )
cHOG0160 hut HUTA1675 Huta_1675 phenylalanyl-tRNA synthetase, alpha subunit
cHOG0160 hvo HVO_2948 HVO_2948 phenylalanyl-tRNA synthetase alpha chain
cHOG0160 nph NP0696A pheS phenylalanyl-tRNA synthetase subunit alpha
cHOG0160 hhi 226 pheS phenylalanyl-tRNA synthetase subunit alpha
MUSCLE (3.6) multiple sequence alignment


2504|gene|nrc1      MQLPTQQVAVLDAASTDDPQRIEALAADTDYPPETIAGAALALEAEGLVAVTETTTTTVS
1675|gene|hut       MELPSDQLAVVEAASADDRRTVEQLSEETGLATAAVTRAAFELEDEGLVAVTETTDESVS
1049|gene|hwa       MQLPDPQLTVLTTASATAETSIEQLADDAELNPTTATQAAFELRDAGLVTITETETTFYE
12966|gene|hma      MKRPQAQVAVLQAADAQEDRRIDDVAAEADLKPEAATRAAFELEADGLLAVSEETLEHYE
226|gene|hhi        MKRPQAQVAVLQAADAQEDRRIDDVAAEADLKPEAATRAAFELEADGLLAVSEETLEHYE
696|gene|nph        MRLPETQLALLEAASATETKTVAQLAEALGEDPAAVTRAAFELETEGLVAVEEHVAEEVA
2671|gene|hla       MRLPERQLAVLEAASATDERTIDEIAAETGLKPETVTGAAFDLRDEGLCSVVETAAETLG
3090|gene|hbo       MKLPESQVAVLNAASATDATTIGSLAEETGLKPETVTQAAFELRDDGYVTVEEREEVEYE
2948|gene|hvo       MRLPESQVAVLNAASATDERTIAQLAEATDQKPETVTGAVFDLRDEGLVSVAETTAESVE
                    *  *  *:::: :*.:     :  ::      . : : *.: *   *  :: *       

2504|gene|nrc1      LTDEGHAYATDGLPEVRLYRAALDAGADD--APVEMGSVIGAAGLDGPQVDIALSNYARK
1675|gene|hut       LTEEGESYLDAGLPEHRLYSAAVEAGADE--GGVSMGQVIGAADLDGAAVDIALSNFARK
1049|gene|hwa       LTDEGQRYLVDGLPEIRLYRAAIDTDTDSDTDSVPLGLIIQSADLDDSEVDIALANFARK
12966|gene|hma      LTEEGDQYVRESLPEQDLYEAAIDAGAAD--GPVQMGQVIGASGLEGGAVDIALSNYARK
226|gene|hhi        LTEEGDQYVRESLPEQDLYEAAIDAGAAD--GPVQMGQVIGASGLEGGAVDIALSNYARK
696|gene|nph        VTEEGDRYRDDGLPEVRLYRAAVDAGADE--EPVELGRLLGSAALDGPEVDIALSNFARK
2671|gene|hla       LTDEGRRYVDDGLPETRLYRAGLALDADE--SAVSMGQVIGEADLDGPEVDIALSNFARK
3090|gene|hbo       LTEEGRQYVEDGLPEVRLYRAAVDAGATA--DPVQMGQVIGASGLGGPEVDIALANFGRK
2948|gene|hvo       LTDEGVEYADEGLPEVRLYRAALDAG-DG--DAVPMGQVIGASSLGGPQVDIALSNFARK
                    :*:**  *   .***  ** *.:  .       * :* ::  : * .  *****:*:.**

2504|gene|nrc1      GYGTIDSGALAADPDA--DPENDPEADALATLT---------------DGDSV--DDDAV
1675|gene|hut       GYGEIESGEITAEPDV--DPNDDAEAAALAAID---------------AGDAV--DDNDV
1049|gene|hwa       SYGSINNGEITATTSI--DPDNDPEATALAQINSIDADAGESENAAGVDSKSIADIDDTV
12966|gene|hma      AYGEIDSGEITANQDA--DPGSDPEMLALEAVA---------------DGRVE-DADADA
226|gene|hhi        AYGEIDSGEITANQDA--DPGSDPEMLALEAVA---------------DGRVE-DADADA
696|gene|nph        GYGHIDSGKVDAAPDPTHDPNADPEAEALDAIA---------------NDNAG-YLDAEV
2671|gene|hla       GFGSIDSGELRVDPDA--DPDADSEAAALAALA---------------DGETP-DAADAV
3090|gene|hbo       GYGSIDSGELAADADA--DAENDPESTVLTTLA---------------DGEAVEDADEET
2948|gene|hvo       GYGHIDSGELAPDADA--DPDADEEAAALAALA---------------AGESV---DGDV
                    .:* *:.* :    .   *.  * *  .*  :                 .         .

2504|gene|nrc1      VDQLASRDLVTVSERTVRSVTLTEAGVTELMAGVEATDEVGELTPELLASGEWADVEFAD
1675|gene|hut       LDQLDRRGLIERDERTVRSVELTDAAVTELMAGIEEAQEVDRLTPDLLTSGDWEDVEFAD
1049|gene|hwa       LEQLITRSLLTQQTDTTRAVSLTDAGVTALMEGVESAETIDRLTPELLTSGEWRDAEFAE
12966|gene|hma      LEQLERRGLLDVREETVRSVQLTDDGVTALMEGVEAAETVDQLTPEMLTSGEWEDVAFTE
226|gene|hhi        LEQLERRGLLDVREETVRSVQLTDDGVTALMEGVEAAETVDQLTPEMLTSGEWEDVAFTE
696|gene|nph        LDRLESRGLIERTETTVRSVTLTDDGVTALMEGIETAETVGAVTPELLASGEWEDVEFAE
2671|gene|hla       LEQLDSRGLVDHGESVTRSVTLTDDGVDALMMGIEATETVAQVTPELLASGEWRDVEFSE
3090|gene|hbo       LDQLVSRNLVERHEETVRSVTLTDDGVTLLMEGVETAETVDRLTPEMLTSGEWEDVEFTE
2948|gene|hvo       LDQLESRNLVVRHERTIRAVTLTDEGVTALMEGVEAAETVDRLTPELLTSGEWEDVEFTE
                    ::.*  *.*:     . *:* **: .*  ** *:* :: :  :**::*:**:* *. *::

2504|gene|nrc1      YNVAADAADHTPGKTHVLRQAAERVTDVLVGMGFQEMAGPHVDADFYINDCLFMPQDHPA
1675|gene|hut       YNVEADAEAIDGGKMHPLRGMAERVKEVLVGMGFEEMNGPHADAEFWINDALFMPQDHPA
1049|gene|hwa       YNVEADAPDIQNGKTHVLRQTAERVRDVLVGMGFEEMDGPHADADFWINDCLFMPQDHPA
12966|gene|hma      YNVEADAEDVSHGKEHILRQTANRVKDTLVGMGFSEMEGPHADAQFWINDCLFMPQDHPA
226|gene|hhi        YNVEADAEDVSHGKEHILRQTANRVKDTLVGMGFSEMEGPHADAQFWINDCLFMPQDHPA
696|gene|nph        YNVEADAEPVNGGKEHILRQTANRVKDVLVGMGFQEMEGPHADADFWINDCLFMPQDHPA
2671|gene|hla       YNVEADAPTTRGGRKHVLRRTADRVKDVLVGMGFQEMEGPHADSDFWINDCLFMPQDHPA
3090|gene|hbo       YNVEADAPEVRTGKTHILRQTADRVKDVLVGMGFQEMEGPHADADFWINDCLFMPQDHPA
2948|gene|hvo       YNVEADAPEARGGKKHILRQTADRVKDVLTGMGFAEMEGPHADADFWINDCLFMPQDHPA
                    *** ***     *. * **  *:** :.*.**** ** ***.*::*:***.*********

2504|gene|nrc1      RNHWDRFALSNPARIDELPDALVERVERAHREGAGDDGDGYHSPWDEDFARALALRGHTT
1675|gene|hut       RTHWDQFALDVP-PMDDLPDGVREDVERAHREGAGPDGEGYHSPWGEEMARQVDLRGHTT
1049|gene|hwa       RTHWDRFALDVP-PIDDLPADLIETVESAHRDGVGSDGDGYHSPWDEDFARAIALRGHTT
12966|gene|hma      RTHWDQFALEEPEEIGHLPPDLVERVRSAHKEGVGPDGEGYHSPWTEDIARGMDLRGHTT
226|gene|hhi        RTHWDQFALEEPEEIGHLPPDLVERVRSAHRDGVGPDGEGYHSPWTEDIARGMDLRGHTT
696|gene|nph        RTHWDRFALDVP-GMDELPADLVERVEDAHRNGVGSEGDGYHSPWDEDFARAVALRGHTT
2671|gene|hla       RTHWDRFALDVD-PMEDIPDELIRRVESAHRDGWGTDGDGYHSPWSEEFAREIALRGHTT
3090|gene|hbo       RTHWDRFALDVP-PIEDVPEDLVDRVEDAHRNGVGPDGDGYHSPWSEDFARAIALRGHTT
2948|gene|hvo       RTHWDRFALDVP-PMEDIPEDLIDRVRDAHLNGVGEDGDGYHSPWSEDFARAIALRGHTT
                    *.***.***.    :  :*  :   *  ** :* * :*:****** *::** : ******

2504|gene|nrc1      SLTARHLAGLADADVEAPARYFSVEKAYRNDTLDATHLLEFFQIEGWVLADDLSVRDLMG
1675|gene|hut       SLSARHLAGVAQGDLEPPQRFFSVEKAYRNDEIDATHLLEFFQIEGWVMAEDLSVRDLMG
1049|gene|hwa       SLSMRYLSGTEIGELEPPQRYFSVEKVYRNDTLDATHLLEFFQIEGWVMAEDLSVRDLMG
12966|gene|hma      SLSMRYLSGHQVGELDPPERYFSVEKVYRNDTLDPTHLLEFFQIEGWVMAEDLSVRDLMG
226|gene|hhi        SLSMRYLSGHQVGELDPPERYFSVEKVYRNDTLDPTHLLEFFQIEGWVMAEDLSVRDLMG
696|gene|nph        SLSMRYLSGHAVGDLEPPQRYFSVEKVYRNDTLDPTHLLEFYQIEGWVMAEDLSVRDLMG
2671|gene|hla       SLSMRYLSGIAGAELEPPQRYFSVEKVYRNDTLDPTHLLEFFQIEGWVMAEDLSVRDLMG
3090|gene|hbo       SLSMRYLSGHEVGDLESPQRYFSVEKVYRNDTLDPTHLLEFYQIEGWVMADDLSVRDLMG
2948|gene|hvo       SLSMRYLSGHEVGELEPPQRYFSVEKVYRNDTLDPTHLLEFYQIEGWVMAEDLSVRDLMG
                    **: *:*:*   .:::.* *:*****.**** :*.******:******:*:*********

2504|gene|nrc1      TFREFYSQFGIHDLQFKPTYNPYTEPSFELFGRHPETGELIEIGNSGIFRPEMLDPLDVD
1675|gene|hut       TFTEFYEQFGITDLEFKPTYNPYTEPSFELFGEHPVTGEVVEIGNSGIFRPEMLDPLSVE
1049|gene|hwa       TFVEFYEQFGITDIQFKPHYNPYTEPSFELFGHHPKTGELIEIGNSGMFRTEVLDPLGVE
12966|gene|hma      TFTEFYEQFGITDLEFKPHYNPYTEPSFELFGTHPETGEVVEVGNSGIFRDEVLTPLGVD
226|gene|hhi        TFTEFYEQFGITDLEFKPHYNPYTEPSFELFGTHPETGEVVEVGNSGIFRDEVLTPLGVD
696|gene|nph        TFTEFYEQFGITDLQFKPHYNPYTEPSFELFGEHPETGELIEIGNSGIFREEVLSPLGVD
2671|gene|hla       TFEEFYRQFGITDIRFKPHYNPYTEPSFELFGEHPETGEEIEIGNSGVFREEVTGPLGVD
3090|gene|hbo       TFEEFYEQFGITDIQFKPHYNPYTEPSFELFGRHPETGELIEIGNSGMFRDEVLEPLGVE
2948|gene|hvo       TFEEFYSHFGITDIQFKPHYNPYTEPSFELFGRHPETGELIEIGNSGMFREEVLRPLGVE
                    ** *** :*** *: *** ************* ** *** :*:****:** *:  **.*:

2504|gene|nrc1      GDVMAWGLALERLLMLMTGFEDIRDVHGTLCDVGFLRNAEVVY
1675|gene|hut       CDVMAWGLALERLMMLVTGAEDIRDVHGTLADLEYLRTEEVRY
1049|gene|hwa       CDVMAWGLALERLAMLTTGAEDIRDLHGTLADLEFLRNAEVTY
12966|gene|hma      CDVMAWGLSLERLLMLMYGFEDIRDVHGTLCDLELLRETEVIR
226|gene|hhi        CDVMAWGLSLERLLMLMYGFEDIRDVHGTLCDLELLRETEVMR
696|gene|nph        CDVMAWGLALERLLMLMYGFEDIRDVHGTLCDLELLRDVEVVQ
2671|gene|hla       CDVMAWGLALERLAMLTTGAEDIRDLHGTLADIEFLRDAEVSY
3090|gene|hbo       CDVMAWGLALERLLMLMYGFDDIRDVHGTMSDLELLREVEVLR
2948|gene|hvo       CDVMAWGLALERLLMLMYGFDDIRDVHGTLCDLDLLRETEVLK
                     *******:**** **  * :****:***:.*:  **  **