HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0016COG0607KOG3772 KOG1530Rhodanese-related sulfurtransferasehypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0016 nrc1 VNG5062c vng5062 no entry
cHOG0016 nrc1 VNG5235c vng5235 no entry
cHOG0016 nrc1 VNG6060c vng6060 no entry
cHOG0016 nrc1 VNG6466c vng6466 no entry
cHOG0016 hmu HMUK0612 Hmuk_0612 beta-lactamase domain protein( EC:3.1.2.6 )
cHOG0016 hmu HMUK3386b Hmuk_3386 beta-lactamase domain protein
cHOG0016 hma RRNAC2076 hypothetical protein
cHOG0016 hma RRNB0286b hypothetical protein
cHOG0016 hwa HQ2288A thiosulfate sulfurtransferase
cHOG0016 hla HLAC2422 Hlac_2422 beta-lactamase domain protein
cHOG0016 hbo HBOR17460 Hbor_17460 Zn-dependent hydrolase, glyoxylase-like
cHOG0016 hbo HBOR18670 Hbor_18670 Zn-dependent hydrolase, glyoxylase-like
cHOG0016 hbo HBOR34680b Hbor_34680 Zn-dependent hydrolase, glyoxylase-like
cHOG0016 hut HUTA0257 Huta_0257 beta-lactamase domain protein
cHOG0016 hvo HVO_1365 HVO_1365 conserved protein YrkH
cHOG0016 nph NP0980A thiosulfate sulfurtransferase / hydrolase ( hydroxyacylglutathione hydrolase ) 1
cHOG0016 hhi 2570 HAH_2570 beta-lactamase domain-containing protein
cHOG0016 hhi 5061 HAH_5061 beta-lactamase domain-containing protein
MUSCLE (3.6) multiple sequence alignment


10286|hp|hma        ---MSSD--DI-----------------------SVVLSDDR------------PPVDTL
2288|gene|hwa       ----------------MDTLLSPDTLATRLDHDESITLLDIRNRSEIDNWRIEAASATRV
12076|hp|hma        ----MAE--DYPDPPTDPPSLSAATLQAKLDAGESVRLLDVRDRGEYEEWRLRGESVTAT
2570|gene|hhi       ----MAD--DYPDPPTDPPSLSAAALQAELDDGESLRLLDVRDRDEYEQWRIRGDSVTAT
17460|gene|hbo      --------------------MTPEELHDRLERGESVTLLDVRNREEYDAWHIDGDSVTTT
18670|gene|hbo      ---MSLP--DLPDLDADVPEITAETLKSRLDDGEELMLLDTRPPAKHEEWRIDADSVTYV
34680|gene|hbo      ---MEGT--QSET-ENSVESITPEQLNAQISDGDGAFILDVRSADNFDEWHIEGPNVESL
257|gene|hut        ---MADV--DFPTPAETAETITPKALKSRIDAGEAVTILDVRMGSEYEKWHIDGDSVETI
5062|chp|nrc1       ---MNAD--DFPTPDADVESVDPESLKDRIDAGEDVTLLDARMTSDYEEWHIDGENVTSI
5235|chp|nrc1       ---MNAD--DFPTPDADVESVDPESLKDRIDAGEDVTLLDARMTSDYEEWHIDGENVTSI
6060|chp|nrc1       ---MNAD--DFPTPDADVESVDPESLKDRIDAGEDVTLLDARMTSDYEEWHIDGENVTSI
6466|chp|nrc1       ---MNAD--DFPTPDADVESVDPESLKDRIDAGEDVTLLDARMTSDYEEWHIDGENVTSI
5061|gene|hhi       MHKMNAD--DFPTPDVDVETTDPESLKDRIDAGEDVTLLDARMQSDYDEWRIDGENVTSL
980|gene|nph        ---MDPEAMDFPTPDATVESTTPRELKERIDAGEPVTLLDARMESDYEEWRIDGDTVESI
2422|gene|hla       ---MDADEMDFPTPDSDVDSIEPESLKARIDDGESVTLLDARMSSDYEEWRIDGPNVESI
                                                         : * *              .   

10286|hp|hma        AVGVSEYGLAGLTA-------VDYLADQ-------------------HSMREVG----HL
2288|gene|hwa       EVPYMKFLAAGASGDP-----ASLLPADATEPVVAVCARGEASDEVATMLRETGIDAVNL
12076|hp|hma        QLPFTKFLQAKVTGEVDSL--VAEVAGT--GPITVICGRGEASAFVAGLLTEHGVEAQNL
2570|gene|hhi       QLPFTKFLQAKVTGEVDDI--VGDVAGT--GPITVVCGRGEASAFVAGLLTEHGIEAQNL
17460|gene|hbo      LVPYSKFMTAEVQGTVEETARKAGLDPD--ELVVAVCGRGEASDYVAELLRDVGYNAENL
18670|gene|hbo      NRPYDNYLDGELTDEL-----VAGLPDD--EEFVVFCAKGHTSEFVAGKLRLAGYDAVAL
34680|gene|hbo      NYPYFELL-DGIPDDL-----LAQLPED--RTITVLCAKGGSSEMIAESIQEEGFDVNHL
257|gene|hut        NVPYYEFLDDDISGDV-----FDSIPDD--RTVTVVCAKGEASEYIAGVLKARGYDAQSV
5062|chp|nrc1       NVPYFEFLEDDIDEDV-----LDQIPDD--REVTVLCAKGGASEFVAGTLAERDYDVDHL
5235|chp|nrc1       NVPYFEFLEDDIDEDV-----LDQIPDD--REVTVLCAKGGASEFVAGTLAERDYDVDHL
6060|chp|nrc1       NVPYFEFLEDDIDEDV-----LDQIPDD--REVTVLCAKGGASEFVAGTLAERDYDVDHL
6466|chp|nrc1       NVPYFEFLEDDIDEDV-----LDQIPDD--REVTVLCAKGGASEFVAGTLAERDYDVDHL
5061|gene|hhi       NIPYFEFLEDDIDSDV-----LAQIPDD--REVTVLCAKGGASEYVAGTLAEHGYDVNHL
980|gene|nph        NIPYFEFLDEDIDDDV-----LASVPDD--EHVTVLCAKGGASEYVAGALADRGYDVDHL
2422|gene|hla       NVPYFQFLDEEIDDDV-----LARIPDD--EHVTVLCAKGGASEYVAGALADRGYDVDHL
                         :                  :                        :   .     :

10286|hp|hma        RTSEPPFSTPFE---------NGTPRHHTRL---------------------------YV
2288|gene|hwa       AGGMEGWGQVYCTTNCA--TESGILKQYRRPSSGCLAYLFVTGESALVIDPLRAFADRYV
12076|hp|hma        SDGMEGWARLYEAREIS-CD-AATVLQYRRPSSGCLGYMIISDGSAAVVDPLRAFTDRYS
2570|gene|hhi       SDGMEGWARLYEAREIT-CD-AATVLQYRRPSSGCLGYMVVSDGSAAVVDPLRAFTDRYV
17460|gene|hbo      EDGMRGWAHVYVSETVP-TDADATVFQYRRPSSGCLAYMLVSSGEAAVIDPLRQFVDRYA
18670|gene|hbo      EDGMEGWARLYEYTELD-TDFDGIVGQYYRPSSGCLAYLIVSDDEAAVVDPLRAFTDRYV
34680|gene|hbo      ERGMKGWARIYEYDELD-VDVAATVAQYRRPSSGCLAYLVASDGEAAVIDPLRAFTDEYV
257|gene|hut        AEGMNGWAEIYEAVEVEGHDGPGTVLQYQRPSSGCLGYLVVDGDEAAVIDPLRAFTDRYL
5062|chp|nrc1       EDGMNGWARIYDAVEVEGYDGAGTLLQYQRPSSGCLGYLLYDDGEAAIIDPLRAFTDRYL
5235|chp|nrc1       EDGMNGWARIYDAVEVEGYDGAGTLLQYQRPSSGCLGYLLYDDGEAAIIDPLRAFTDRYL
6060|chp|nrc1       EDGMNGWARIYDAVEVEGYDGAGTLLQYQRPSSGCLGYLLYDDGEAAIIDPLRAFTDRYL
6466|chp|nrc1       EDGMNGWARIYDAVEVEGYDGAGTLLQYQRPSSGCLGYLLYDDGEAAIIDPLRAFTDRYL
5061|gene|hhi       EDGMNGWASIYEAVEVERYDGTGTLLQYQRPSSGCLGYLLYDDGEAAIIDPLRAFTDRYL
980|gene|nph        ADGMNGWASIYEPHEVTGYDGAGTLLQYQRPSSGCLGYFLYHDGEAAVIDPLRAFTDRYL
2422|gene|hla       EDGMNGWASIYETHEVTDYDGPGTLIQYQRPSSGCLGYLLYDGGEAAIVDPLRAFTDRYL
                      .   :.  :           .   :: *                            * 

10286|hp|hma        DEASSFAVLVGERFVPPAQAGSLAGA--IAT-AGRKLGVSDITMLTGV------------
2288|gene|hwa       ADAKEMGAELVAVVDTHVHADHISGLRTVTA-RGATPYMSSKAIDRGVTF----------
12076|hp|hma        ADAADRDASITHAIDTHVHADHISGVRRLAVETGAEPILSERAVARGV------------
2570|gene|hhi       TDAADHDASLTHAIDTHVHADHVSGVRRLAAETGAEPILSERAVARGV------------
17460|gene|hbo      ADAREYGADIVSVIDTHVHADHVSGVRELADAVDATPVYPAAAEARGLVAD---------
18670|gene|hbo      TDAAEYGASIEYVIDTHVHADHISGLRELAAETGAKTVLSATAADRGVAYV---------
34680|gene|hbo      QDARALGTDLTYALDTHVHADHISGIRTLSEQTDATAVLPAPAVARGVEYD---------
257|gene|hut        DDAEDHDADLVYALDTHVHADHVSGIRALAD-AGVEAVLPAAAIDRGVEDA---------
5062|chp|nrc1       DDADNLGVDLQYALDTHVHADHISGVRNLAE-EDIEGVIPEAAVDRGITYA---------
5235|chp|nrc1       DDADNLGVDLQYALDTHVHADHISGVRNLAE-EDIEGVIPEAAVDRGITYA---------
6060|chp|nrc1       DDADNLGVDLQYALDTHVHADHISGVRNLAE-EDIEGVIPEAAVDRGITYA---------
6466|chp|nrc1       DDADNLGVDLQYALDTHVHADHISGVRNLAE-EDIEGVIPEAAVDRGITYA---------
5061|gene|hhi       DDAAELGVELKYALDTHIHADHISGVRDLDA-EGVEGVIPEAAVDRGVTYAAEQGSTGPA
980|gene|nph        DDADELGVELRYAFDTHVHADHVSGLRDLAA-EGVEAVLPGPAADRGVTYT---------
2422|gene|hla       ADAEELGVELTYAFDTHVHADHISGLRNLAD-EGVEAMLPAAAADRGVTYA---------
                     :*    . :   . .  :*. ::*   :    .     .  :   *:            

10286|hp|hma        -----------PIAHGPDDHVPFYIATPMYQESYLNDTDIRPMGNGFL---DGLSAELVT
2288|gene|hwa       --------DVESLAPGTAFTIGDTAIDVLASPGHTTGGISLAIDGYLVC-GDTLFLDGVA
12076|hp|hma        -------DDVTALAADETLRVGSATLEPRPLPGHTTGMTGFTVGDVLLA-GDSVFLDSVA
2570|gene|hhi       -------DDVTALAADETLRVGSATLEPRPLPGHTTGMTGFTVGDVLLA-GDSVFLDSVA
17460|gene|hbo      -------SATKLVSDGDEIHVGDVTLTAVHTPGHTSEMTAFQIDDSCFS-GDGLFLDSVA
18670|gene|hbo      -------VDV-LVEDGDTITLGDADIKVIHTPGHTSGMTSLLVGDVLLT-GDGLFTDSVA
34680|gene|hbo      -------VPFEQVADGDTLSVGNVDIEVIHTPGHTSGMTAYKVGDVLFT-GDGLFTESVA
257|gene|hut        -------DDLTAAEDGDVFTIGDVEIEAIHTPGHTTGMTSYLVGDALLATGDGLFVESVA
5062|chp|nrc1       -------DDMTTAADGDTFDVGDATIEAVYTPGHTTGMTSYLVDDSLLATGDGLFIESVA
5235|chp|nrc1       -------DDMTTAADGDTFDVGDATIEAVYTPGHTTGMTSYLVDDSLLATGDGLFIESVA
6060|chp|nrc1       -------DDMTTAADGDTFDVGDATIEAVYTPGHTTGMTSYLVDDSLLATGDGLFIESVA
6466|chp|nrc1       -------DDMTTAADGDTFDVGDATIEAVYTPGHTTGMTSYLVDDSLLATGDGLFIESVA
5061|gene|hhi       SQARQDTDDLTTAEDGDTFQVGDATIETVSTPGHTTGMTSYLVDGSLLATGDGLFIESVA
980|gene|nph        -------DEVTLTQDGDTFPVGEATIETVFTPGHTTGMTSYLVDEGFLATGDGLFIESVA
2422|gene|hla       -------DDVTLVEDGDEFTVGDATVETVFTPGHTTGMTSYLLGDSLLATGDGLFIESVA
                                   .    :           .: .      :.   .   * :  : *:

10286|hp|hma        R--------GIDE--------------SLPTGVFTTPTH-----PQAPDAAAAIRLLTAL
2288|gene|hwa       RPDLEA-DNNAQAFAYDLHRTVTERFADLPDDTVIAPGHYHDGAPQSSDGSYTARLGDLR
12076|hp|hma        RPDLEAGADGARDLARDLHRTLTDRLAALPDETLVAPGHYSESTVPSDDGTFTAPLGGLR
2570|gene|hhi       RPDLEAGADGARDLARDLHRTLTERLATLPGETVVAPGHYSESTTPADDGTFTAALGTLR
17460|gene|hbo      RPDLEHGDEGAEDAARRLYETFQSVYGTFDDDVRVAPAHCGEATERAVDGTYTARLGTLR
18670|gene|hbo      RPDLEAGSEGATDAARTLYETIHERILPLSDGTRIAPAHTASATATSVDGTYTASLGELT
34680|gene|hbo      RPDLED-PEAATDAARTLYTSLTEKVLPLPDETVVAPAHFSDAATPNDDATYTAELGTLT
257|gene|hut        RPDLEAGDDGAEDAARQLYETLQDRILTLADDVLIAGGHTSDAAEPAADGTYTAPLGDLR
5062|chp|nrc1       RPDLEEGDDGAPDAARMLYESLQERVLTLPDDTLVGGAHFSDAADPAADGTYTAPIGELV
5235|chp|nrc1       RPDLEEGDDGAPDAARMLYESLQERVLTLPDDTLVGGAHFSDAADPAADGTYTAPIGELV
6060|chp|nrc1       RPDLEEGDDGAPDAARMLYESLQERVLTLPDDTLVGGAHFSDAADPAADGTYTAPIGELV
6466|chp|nrc1       RPDLEEGDDGAPDAARMLYESLQERVLTLPDDTLVGGAHFSDAADPAADGTYTAPIGELV
5061|gene|hhi       RPDLEEGDEGAPEAARMLYESLQERVLTLPDGTLIGGAHFSDAAEPAEDSTFTAPISALV
980|gene|nph        RPDLEEGDEGAPDAARTLYQSLQERVRTLPDETLIGGAHFSDAAAPASDGTYTATLGALD
2422|gene|hla       RPDLEEGDDGAPEAARMLYDSLQTRVLSLDDNVLVGGAHFSDAAEPAADGTYTAPIGELR
                    *                           :   .     *         *.: :  :    

10286|hp|hma        KESHSIQIDTGPLENFAANIEAHYQALAERMDAAD--SDQFADDRMYM------------
2288|gene|hwa       EQLWPFTSDSDTFVERAVSDLGPRPANDERIIRINLGREQINDQEAFELEIGPNNCAVAA
12076|hp|hma        DQLPGFTMDREAFVEYVCDDIPPRPANFERVIAINLGTETADDDTAFELELGPNNCAAAP
2570|gene|hhi       DRLPGFAMDREAFVEYACDDIPPRPANFERIIAINLGTETADDDTAFELELGPNNCAAAP
17460|gene|hbo      DRLPALSMDEAEFVEYVLDDMPPRPANYEEIIEMNLGRSEVEDDEAFELELGPNNCAVSQ
18670|gene|hbo      AHMEALRYDRDSFVEYVLADMPPRPANYEEIIETNLGQTDVNDEEAFTLELGPNNCAAES
34680|gene|hbo      ETMDALAMDEDEFIEFIVADMPPRPANYEEIIATNLGLESLDDEKAFELELGPNNCAASN
257|gene|hut        AEMEALSMDEDDFVELILADMPPRPANFEDIIATNLGQNWIDDEEAFTLELGPNNCAASQ
5062|chp|nrc1       DEMDALTMDEQAFVDLVLSDMPPRPANYEDIIATNLGQNAVDDEEAFTLELGPNNCAASQ
5235|chp|nrc1       DEMDALTMDEQAFVDLVLSDMPPRPANYEDIIATNLGQNAVDDEEAFTLELGPNNCAASQ
6060|chp|nrc1       DEMDALTMDEQAFVDLVLSDMPPRPANYEDIIATNLGQNAVDDEEAFTLELGPNNCAASQ
6466|chp|nrc1       DEMDALTMDEQAFVDLVLSDMPPRPANYEDIIATNLGQNAVDDEEAFTLELGPNNCAASQ
5061|gene|hhi       EEMDALTMDEDAFVELVLSDMPPRPANYEEIIATNLGQNAVDDEEAFTLELGPNNCAASQ
980|gene|nph        SRMDALSMDEDEFVDLVLSDMPPRPANYEDIIETNLGQREIDDEEAFTLELGPNNCAASQ
2422|gene|hla       ERMDALSADEDEFVETVLADMPPRPANYEDIIATNLGQNAVDDDEAFTLELGPNNCAASQ
                         :  *   : :          *  * :   :       *:  :             

10286|hp|hma        -------
2288|gene|hwa       D------
12076|hp|hma        TDTV---
2570|gene|hhi       SDAV---
17460|gene|hbo      AD-----
18670|gene|hbo      TI-----
34680|gene|hbo      GALTN--
257|gene|hut        DSLAGD-
5062|chp|nrc1       DSLAGD-
5235|chp|nrc1       DSLAGD-
6060|chp|nrc1       DSLAGD-
6466|chp|nrc1       DSLAGD-
5061|gene|hhi       ESLAGD-
980|gene|nph        DALTGD-
2422|gene|hla       DALTSDD