HOG Organism Gene ID Name Annotation
aHOG1597 hbo HBOR09170 Hbor_09170 hypothetical protein
aHOG1597 hla HLAC2180 Hlac_2180 hypothetical protein
aHOG1597 hwa HQ2768 hypothetical protein
aHOG1597 nph NP4908 hypothetical protein
aHOG1597 nrc1 VNG1723 vng1723 no entry
MUSCLE (3.6) multiple sequence alignment


4908|hp|nph       MATMGATDAEGRRRLLVEHILAVRRDGGTVTFVAGDTR------------VGYEDRRLRL
1723|hp|nrc1      MTRFDADTEAARIELVADTVAAHRDRDSQFCTLEAAADASDTPESLP-PWVQFADGTLNL
2180|hp|hla       MTRFDAATEGERLKLFADAATAHRARSSEVMTVDVDPDSDTTGGGEVPPWIQLAGTELIL
9170|hp|hbo       MTRFDADSPKERRKLFAEAVTAHRTRASPFLTVEVEHDPDVDGEDSPAPWVQFADQTFNM
2768|hp|hwa       MTRFDAKTPKERRTLFAEAITAHRERASAFMTLEADSRPDNKDEGVPAPWVQFAENMFNL
                  *: :.*     *  *..:   * *   . .  :                 :      : :

4908|hp|nph       DAAADERERLATLLSEYHVFKIK-----QPETRTADDGV-VYLSAVTDAKHAADFVEALF
1723|hp|nrc1      DCTDGELEALHTTLSRYGAFTIADRTTVEPDTAEESPGTNVRIDARADDDRVGQFVDTVF
2180|hp|hla       DCTDAELDLLKDLLGEFPEFRID-----ELVSPEEAEGTNAVVTARSDANRVAGFVERAF
9170|hp|hbo       DVTEEELECAKSLLSEFPEFRID-----QMESPEEAEGTNLRIIARSDANRLAAFVDRVF
2768|hp|hwa       DVTESELERVHTLVGEFPEFRVE-----QLESPEDTEATNVRITARSDANRLAAFADRIF
                  * :  * :     :. :  * :      :  :     ..   : * :* .. . *.:  *

4908|hp|nph       RTVYGADEDYELRVE--
1723|hp|nrc1      QAVYGLPADFELWAVEI
2180|hp|hla       REVYGLDDDYRAWVTAI
9170|hp|hbo       TDVYGRDEDYCAWVAAV
2768|hp|hwa       IDVYNCPNEYQAWATAV
                    **.   ::  ..