HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0159COG0494 COG1018KOG4313 KOG2839 KOG2937 KOG3041 KOG3069arCOG01083/2Flavodoxin reductases (ferrodoxin-NADPH reductases) family 1

HOG Organism Gene ID Name Annotation
cHOG0159 nrc1 VNG0475 fpr Flavodoxin reductases (ferrodoxin-NADPH reductases) family 1
cHOG0159 hmu HMUK3086 Hmuk_3086 Oxidoreductase FAD-binding domain protein( EC:1.18.1.3,EC:1.6.2.2 )
cHOG0159 hma RRNAC0717 FAD/NAD binding oxidoreductase
cHOG0159 hwa HQ1537A electron transfer protein
cHOG0159 hla HLAC0929 Hlac_929 Oxidoreductase FAD-binding domain protein
cHOG0159 hbo HBOR23320 Hbor_23320 flavodoxin reductase family protein( EC:1.18.1.3,EC:1.6.2.2 )
cHOG0159 hut HUTA0896 Huta_0896 Oxidoreductase FAD-binding domain protein
cHOG0159 hvo HVO_0889 HVO_0889 FAD/NAD binding oxidoreductase
cHOG0159 nph NP1230A homolog to cytochrome-b5 reductase
cHOG0159 hhi 1365 fixC2 FAD/NAD binding oxidoreductase
MUSCLE (3.6) multiple sequence alignment


475|chp|nrc1        ---------------------MDETPVTVQAVDDVGPDAIAVTFETPAGFTAEPGQFVRV
1537|gene|hwa       ----------------------MDATVTVKEAQSVGPQTVAITMQSPPAFTAKPGQFLRV
929|gene|hla        ----------------------MDTTATVSAVETVGRDTYALRFDAPDGFAAEPGQFVKL
23320|gene|hbo      ----------------------MDTTVTVAAVRDVGPETVAIEFESPDGFEADPGQFVKL
1230|gene|nph       ---------------------MDPIETTVAAVREVGPDAVAIDIETPSGFEAAPGQFVKL
896|gene|hut        ---------------------MDRTTTIVEAIRSVGSDAVAIGLATPTDFDASPGQFVKF
10717|gene|hma      MPVGVKLRDRNPLAQSRQLSGMDEQVLDVVAVRDVGPDTVAIDFETPEAFDAQPGQFVKL
1365|gene|hhi       MLANVKLRDRNPLAQSRQLSGMDERVLDVVAVRDVGPDTVAIDFETPDAFDAQPGQFVKL
                                                *     ** :: *: : :*  * * ****:..

475|chp|nrc1        VREFEDGETEGRYYTLSSPTVADTFEVTVDVAPD--GVLGPWLAGRDPGDEVTVEGPFGE
1537|gene|hwa       TATI-DDEEYARFYTISSPDVEETIEITVGIDPSDAGPFSQYLADIESGSKLSIAGPFGQ
929|gene|hla        GTEI-DGESVARFYTLSSPTIDDTFEVTVGIDTDEGGEFSAFLADAEAGTEMTLSGPFGD
23320|gene|hbo      SAAV-EGEEYSRFYTLSSPDVEGTFEVTVGIDPEEAGPFSQFLVDLDTGDTLDVSGPFGQ
1230|gene|nph       SAEL-DGDTTGRFYTVSSPDTEAVFEITVGYDAEEAGAFSEYLQAIEAGDTVTITGPFGN
896|gene|hut        SLPA--VSDHSRFYTVSSPAVRDTFEITVEIDPD--GELGPHIADLAVGDEVAISGPFGS
10717|gene|hma      TLGV-DGEDISRFYTISSPTVDEAFEITVGIDPD--GELAPQLGALEAGDGVRIAGPFGS
1365|gene|hhi       TLTV-DGEDISRFYTISSPTVDGAFEITVGIDPD--GELAPQLGALEAGDGVRIAGPFGS
                           .  .*:**:***    .:*:**   ..  * :.  :     *  : : ****.

475|chp|nrc1        DYYQGEPSVLLLAGGPGVGPAVAIAERAMDAGAEVALVYQDE--APVHEPRLAALSDAGA
1537|gene|hwa       HYYEDSDRAVVLAGGPGIGPAVGIGDAAGAAGNEVAIVYVSETATPAHRPRLNALADAGN
929|gene|hla        QHYDGEPRAVVIAGGPGVGPAVAIAERALDDGAEAAVVYRDD--DVSHADRLGRLEARGA
23320|gene|hbo      SYYQGESRAVVLAGGPGIGPAVGIGEAAVADGNQVAIIYQTS--APAHEERLDELRDAGA
1230|gene|nph       DYYEGEPRAVIIAGGPGVGPAVAIAERALADGHDAAVVYVDD--EPLHEDRLASLSAGGA
896|gene|hut        AYYEGEDRVVVLAGGPGVGPAIGIAERALDDDGEAALVYRDD--EPIHADRLDALADRGA
10717|gene|hma      DYYEGESRAVVLAGGPGVGPAVGIAERALDDGNEAAVVYQDD--APVHEDRLDALAEAGA
1365|gene|hhi       DYYEGESRVVVLAGGPGVGPAVGIAERALDDGNEAAVVYQDD--APVHEDRLDALAKAGA
                     :*:..  .:::*****:***:.*.: *   . :.*::*  .     *  **  *   * 

475|chp|nrc1        DVLVVTD-----------AFEDAVA-TLADASDQAAFVYGFAAFCGAATDALEAEGFDTD
1537|gene|hwa       NVTIFTTASDSQSGIVPPEFDDAVADIITGASTEQTFVYGFEGFIEAATDALESASINPD
929|gene|hla        AVHLLDADD---------ELDDAVAEALTGSEGETVFVYGFADLVADAEAAIEAAGSDAD
23320|gene|hbo      SVVITDD-----------EITDAVADVVTDGAEEQVFVYGFSDFVAAAEGAIDAAGGDSD
1230|gene|nph       NVLVLNGAE---------QLGDAVADAVTNGDGEQVFVYGFSSFLEDATAAIEAAGGDAD
896|gene|hut        FVRLPETDG---------GVADAVREAITGDPDEQVFVYGFADFLDVATDAIETAGGDAE
10717|gene|hma      LVSVIDSEE---------SLAEPVADAIEDGG--QVFIYGFADFLDAATEALEAAGVSTD
1365|gene|hhi       LVSVIDDDE---------PLTEPVAEAVEDGG--QVFIYGFADFLDAATEALEDAGVSTD
                     * :               . :.*   : .     .*:***  :   *  *::  . ..:

475|chp|nrc1        AVKVESFGPEP
1537|gene|hwa       EAKIENFG---
929|gene|hla        AAKVENFG---
23320|gene|hbo      AAKVENFG---
1230|gene|nph       AAKTENFG---
896|gene|hut        AAKVENFG---
10717|gene|hma      DAKVENFG---
1365|gene|hhi       DAKVENFG---
                     .* *.**