HOG Organism Gene ID Name Annotation
aHOG1578 hhi 770 HAH_0770 putative DNA binding protein
aHOG1578 hbo HBOR08420 Hbor_08420 predicted transcriptional regulator, COG4742
aHOG1578 hmu HMUK1534 Hmuk_1534 putative DNA binding protein
aHOG1578 hwa HQ3043 hypothetical protein
aHOG1578 nph NP3804 hypothetical protein
aHOG1578 hma Hma_10006 putative DNA binding protein
MUSCLE (3.6) multiple sequence alignment


3804|hp|nph         ----------------------------MEFLARSGNRIAVLEAVSERPHTRSELAERTG
3043|hp|hwa         MQREMIARGEERMSWDMIQYSMDEALSEIEFLSRSANRVLVLECLAEDRYTRGELGEEIG
8420|hp|hbo         ---------------------MDVALEEIEFLALSANRVEVLDALRKASLTRHELEAETD
770|gene|hhi        ---------------------MESALEEIEFLALSSNRVEVLRLLATEPHSRGELAAETG
10006|gene|hma      ---------------------MESALEEIEFLALSSNRVEVLRLLATEPHSRGELAAETG
                                                :***: *.**: **  :     :* **    .

3804|hp|nph         ASQATLGRILRDFEERNWLARTDGAYVATPTGNLVADGVLDLRKRLETERRLRPVVGMLP
3043|hp|hwa         ASQATLGRILEDFTERSWIRHDGTEYVATATGRLVAGSVTDLLESLETETKLREIIDYLP
8420|hp|hbo         ASQPTLGRILRDFTDRGWIEHDGNRYAATATGRLVAAAFTDLLETMETELKLRDVVEWLP
770|gene|hhi        ASQATLGRIIADFEERSWIRRTGGEYVATATGRIVANGFTDLLGSLETEQRLRDIVQYLP
10006|gene|hma      ASQATLGRIIADFEERSWIRRTGGEYVATATGRIVANGFTDLLGSLETERRLRDIVQYLP
                    ***.*****: ** :*.*: . .  *.**.**.:** .. **   :*** .** ::  **

3804|hp|nph         -DELDVDLRRLRTATLTTPTETRPSAPVTRSLDILREAGHIRAVSRALNDRTLRLLRRRA
3043|hp|hwa         THAMDFDLEHLSDATITVPTQTRPSAPLREVLAVMEDATHLRVFSHAFNEQSIEIVERRV
8420|hp|hbo         TEEMDFDLRRLADATITVPTRTKPGAPVQRVLELLRESTHVQIFSHAFNEQSLDVVREQT
770|gene|hhi        TDAMAFDLQHLADATITVPSQTRPNAPVQRLLDLLRDAEEVRTFSHAFNDQAIRVVQERV
10006|gene|hma      TDAMAFDLQHLADATITVPSQTRPNAPVQRLLDLLRDAEEVRTFSHAFNDQAIRVVQERV
                       : .** .*  **:*.*: *.*.**:   * :: ::  :. .*.*:*:.:: ::  ..

3804|hp|nph         VADGCTVDGVFAARAIEALVDDDRLRPKLRELVAAESADIHVYEGPLSLAVTLADGTVSL
3043|hp|hwa         RTGAQTFEAVLSESAITAIADNQTLWEQLQSLASADDGRLRVRADGVPLAATLTNDTVVF
8420|hp|hbo         VAGSQTFEGVFSPDALDAIAHDSTLRQRLEDLLDADAAEIRLHDEPIPLAVTITDDVVHL
770|gene|hhi        TAGEQRFSGVFSPGAIDALAADDRLRKRLESLRAEPDASVRVRTDGVPLAVMIADDVVHL
10006|gene|hma      TAGEQRFSGVFSPGAIDALAADDRLRKRLESLRAEPDASVRVRTDGVPLAVMIADDVVHL
                     :.   ...*::  *: *:. :. *. .* .*     . :.:    :.**. :::..* :

3804|hp|nph         LLRDDDGVVQAALDTDDEAVAEWAASVHEQHRTAAEPLSPADIV----
3043|hp|hwa         LLRDGRGLVQASLASSNDRVYQWAVETHDHYWRTAASFDPEQYDATIS
8420|hp|hbo         LLRDEDGLLRAALDTDDDAVLSWARDMHEQYWQAASPLDASDLH----
770|gene|hhi        LLRDDNGVLQASIDTTAPAVREWAIEAFDAYWASAEPLSDEWAL----
10006|gene|hma      LLRDDNGVLQASIDTTAPAVREWAIEAFDAYWASAEPLSDEWAL----
                    ****  *::.*:: :    * .** . .: :. :* .:.