HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0157COG2108arCOG00932Uncharacterized conserved protein related to pyruvate formate-lyase activating enzymehypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0157 nrc1 VNG2155 vng2155 no entry
cHOG0157 hmu HMUK0936 Hmuk_0936 Radical SAM domain protein
cHOG0157 hma RRNAC2733 hypothetical protein
cHOG0157 hwa HQ3257A hypothetical protein
cHOG0157 hla HLAC0312 Hlac_312 Radical SAM domain protein
cHOG0157 hbo HBOR28710 Hbor_28710 pyruvate formate-lyase activating-like enzyme
cHOG0157 hut HUTA1246 Huta_1246 Radical SAM domain protein
cHOG0157 hvo HVO_0300 HVO_0300 radical SAM domain protein protein
cHOG0157 nph NP5164A hypothetical protein
cHOG0157 hhi 19 HAH_0019 radical SAM domain-containing protein
MUSCLE (3.6) multiple sequence alignment


1246|gene|hut       ----MISEGCEQCAKGGKMVIFVYGYCDQRDCFYCPLGENRKNVTDVYANERKVEDDQDL
5164|hp|nph         ----MISEGCEQCAVGGKMVLFVYGYCDQRDCFYCPLGENRKNVTQVYANERPVETESDI
12733|hp|hma        ----MISEGCEQCAKGGKMVLFVYGYCDQRDCFYCPLGENRKNVTQMYANERPIEDDADV
19|gene|hhi         ------------------MVLFVYGYCDQRDCFYCPLGENRKNVTQMYANERPVEDDSDV
3257|hp|hwa         ----MISKGCEQCAKGGKMVLFVYGYCDQRDCFYCPLGENRKNVTDVYANERLVESDSDI
2155|chp|nrc1       MRHQMISKGCEQCAEGGKMVLFVYGYCDQRDCFYCPLGENRKNVQQVYANERPVEDDEDI
312|gene|hla        ----MISKGCEQCAKGGKMVLFVYGYCDQRDCFYCPLGENRKNVTDVYANERKVESNEDV
28710|gene|hbo      ----MISKGCEQCAMGGKMVLFVYGYCDQRDCFYCPLGENRKNVTDVYANERLVESDDDV
                                      **:*********************** ::***** :* : *:

1246|gene|hut       IEEAKRMDALGSSLTGGEPQEVMDRTCRYISLLKDEFGEDHHIHLYTGITGGRENMRRLA
5164|hp|nph         IEEAKRMDALGSSITGGEPQEVLERTCNYISLLKDEFGEDHHTHLYTGITGGEENMRRLA
12733|hp|hma        IEEAKRMSALGTSITGGEPQEVLDRTCHYLELLKDEFGEDHHTHLYTGIPGGRENMRRLS
19|gene|hhi         IEEAKRMSALGTSITGGEPQEVLDRTCHYLELLKEEFGEDHHTHLYTGIPGGRENMRRLS
3257|hp|hwa         IAEAHRMDALGTSITGGEPQEALAKTTRYLSLLKDEFGSDHHTHLYTGITGGRENMRALA
2155|chp|nrc1       ISEAKLMDALGTSITGGEPQEVLDRTCRYLRLLKDEFGEDHHTHLYTGITGGRENMRRLS
312|gene|hla        IAEAKRMSALGTSITGGEPQEAMAKTCRYLELLKDEFGEDHHTHLYTGITGGRENMRRLS
28710|gene|hbo      ISEAKRMDALGTSITGGEPQEALDKTCHYLSLLKDEFGEDHHTHLYTGITGGRENMRRLS
                    * **: *.***:*:*******.: .* .*: ***:***.*** ******.** **** *:

1246|gene|hut       EAGLDEIRFHPPLDMWGDLHGTEWEDILYIAREEGLTPAFEIPGIRPEDEFITFVEEGAA
5164|hp|nph         EAGLDEIRFHPPLEQWGDLHGTEWEDILYTARDAGITPAFEIPGIRAEPEFLEFLDEGAA
12733|hp|hma        EAGLDEIRFHPPLEQWGDLHGTEWEDILYIAREEGLTPAFEIPGIRAEEEFLEFLDEGAA
19|gene|hhi         EAGLDEIRFHPPLEQWGDLHGTEWEDILYIAREEGLTPAFEIPGIRAEEEFLEFLDEGAA
3257|hp|hwa         SAGLDEIRFHPPYEQWGNLHDTEWEDILYIAREEGLTPAFEIPGIRAEPEFLEFLDEGAA
2155|chp|nrc1       EAGLDEIRFHPPYELWGDMHGTEWEEILYIAREEGLTPAFEIPGIRAEDEFLEFLDEGAA
312|gene|hla        EAGLDEIRFHPPLEMWGDMHGTEWEDILHIAREEGLTPAFEIPGIRAEPEFLEFLDEGAA
28710|gene|hbo      EAGLDEIRFHPPYELWGDMHGTEWEEILYIAREEGLTPAFEIPGIRAEQEFLDFLDEGAA
                    .*********** : **::*.****:**: **: *:**********.* **: *::****

1246|gene|hut       EFVNVNEFEMSQGNYRRMQQKGFDLKEDHMSAVEGSH--DVLDSMAKHPKVYFCTSVFKD
5164|hp|nph         EFCNINEFEMSDGNYRRMQEAGFELREDHMSAVEGSH--DILETMGDHERVYFCTSVFKD
12733|hp|hma        DFCNINEFEMSDGNYRRMQEEGFELKEDHMSAVEGSH--DILEKMGDHEKVYFCTSVFKD
19|gene|hhi         DFCNINEFEMSDGNYRRMQEEGFELKEDHMSAVEGSH--DILEKMGDHEKVYFCTSVFKD
3257|hp|hwa         EFCNVNEFEMSDGNYRRMQQKGYELQDGHMSAVEGSK-EAILDTMGNHEQVYFCTSVFKD
2155|chp|nrc1       DFCNINEFEMSDGNYERMQEAGYELQEGHMSAVDGSK-DAILSEMADHEQVYFCTSVFKD
312|gene|hla        EFCNINEFEMSDGNYRRMQEEGFELQEGHMSAVEGSKDDSIVSEMASHEKVYFCTSVFKD
28710|gene|hbo      EFCNVNEFEMSDGNYRRMQEEGFELQDGHMSAVDGSK-DAILDAMADHERVYFCTSVFKD
                    :* *:******:*** ***: *::*.:.*****:**:   ::. *..* .**********

1246|gene|hut       AAQHRNRLKRMAKNVRRPFDETTDDGTLVYGKAWVDADRLDELGVPAEYYVEKSEHVEVA
5164|hp|nph         AAQHRSRLKRMARNVRREFDEITDDGTIVYGKTWVTETRLDELGVPESYYTVKSDHVELA
12733|hp|hma        AAQHRSRLKRMARNIRRPFDDVTDDGTLVYGKAWTSEARLETLGVPEEYYTVKSEHVELA
19|gene|hhi         AAQHRSRLKRMARNIRRPFDDVTDDGTLVYGKAWTSEARLETLGVPEEYYTVKSEHVELA
3257|hp|hwa         AAQHRNRLKRMAQTVRRPFDEITDDGTIVYGKTWVAPKRFDSLGVPDEFYTVKSDHVEIA
2155|chp|nrc1       AAQHRSRLKRMARNVRREFDEITDDGTLVYGKTTVGAGRIRELGVPEEYYTVKSDHVEVA
312|gene|hla        AAQHRNRLKRMAKNIRREFDEVTDDGTLVYGKAFADADRFEALGVPEEFYTVKSDHVEVA
28710|gene|hbo      AAQHRNRLKRMAKNIRRPFDEVTDDGTLVYGKTWVTEDDLQALGVPEEFYTVKSDHVEVA
                    *****.******..:** **: *****:****: .    :  **** .:*. **:***:*

1246|gene|hut       WWLLEEMIAEGDIAEGEIVEQYPTVDGTVVERTPLPDGSIEGTESAQSVRAE
5164|hp|nph         WWLLEEMVDEGDIEDGEIVEQYPTYDGTVVERTPLA----------------
12733|hp|hma        WWLLEEMVEEGDVEKGEIVEQYPTYDGTVVERTPLSNGADAGRATADD----
19|gene|hhi         WWLLEEMVEEGDVEKGEIVEQYPTYDGTVVERTPLSNGADAGRATADD----
3257|hp|hwa         WWLLEEMIEDGDVDDGEIVEQYPTVDGTVVERTPLA----------------
2155|chp|nrc1       WWLLEEMIDDGDIDDGEIVEQYPTYDGQVVERTPLA----------------
312|gene|hla        WWLLEEMVEDGDLDRGEIVEQYPTTDGTVVERTPVA----------------
28710|gene|hbo      WWLLEEMIEEGDVPEGEIVEQYPTVNGTVVERTPLA----------------
                    *******: :**:  ********* :* ******:.