HOG Organism Gene ID Name Annotation
aHOG1566 hhi 2468 malQ 4-alpha-glucanotransferase
aHOG1566 hbo HBOR15290 Hbor_15290 4-alpha-glucanotransferase( EC:2.4.1.25 )
aHOG1566 hla HLAC1505 Hlac_1505 4-alpha-glucanotransferase
aHOG1566 hut HUTA1049 Huta_1049 4-alpha-glucanotransferase
aHOG1566 hwa HQ2578 malQ 4-alpha-glucanotransferase
aHOG1566 hma Hma_11957 malQ 4-alpha-glucanotransferase
MUSCLE (3.6) multiple sequence alignment


1505|gene|hla       ------------------------------------------------------------
1049|gene|hut       ------------------------------------------------------------
2468|gene|hhi       ------------------------------------------------------------
11957|gene|hma      MDTIYMFAYPRRRVLTRIRRRSLLTGRSSPLALPRAAHFVRAPRPEKPRPLKCLSGQQVR
2578|gene|hwa       ------------------------------------------------------------
15290|gene|hbo      ------------------------------------------------------------
                                                                                

1505|gene|hla       MRLDRSSGVFCHVTSLPGRHGIGDLGDGAKAFLSFLGDADIGHWQVCPLGPTMGAAGESP
1049|gene|hut       MSFDRQSGVFLHLTSLPSPHGIGDLGDGARTFLDFLERAEQSLWQFCPVTPTRGVHGHSP
2468|gene|hhi       --------MFLHQTSLPGPHGIGDLGAGARAFVDFLDRADQSLWQFCPLGPTASIHGNSP
11957|gene|hma      MQFERQSGVFLHLTSLPGPHGIGDLGAGARAFVDFLDRADQSLWQFCPLGPTASIHGNSP
2578|gene|hwa       MQFDRQAGVFAHITALPGPHGIGDLGPGARNFLEWLETANQSVWQFCPLGPTAGIHDDSP
15290|gene|hbo      MRFDRQSGVFAHVPSLPGPHGIGDLGDGARAFIDWLASAEQSLWQFCPLGPTASIHGHSP
                            :* * .:**. ******* **. *:.:*  *: . **.**: ** .  . **

1505|gene|hla       YQSPSAFAGNPLLIDLDGLVDDGWLDESDLE-PIPDFPEDRVDYDAVREYKQPLLRTAFE
1049|gene|hut       YASPSAFAGNPLLVDLTALVERGWLDEETLENPPGD--PRTVQYDTVTDFKRERLSAAFD
2468|gene|hhi       YQSSSAFAGNPLLIDLRDLVDRGYLTADEVD-PPEDFSQQHVKYDRVTEFKERRLRTAYE
11957|gene|hma      YQSSSAFAGNPLLIDLRDLTDRGYLTEADTE-PPDDFSGQQVNYDRVTEFKEARLRDAYA
2578|gene|hwa       YQSYSAFAGNPLIISLDDLVADGYLTNEDLK-PVPDFSPHEVAYDAVREYKHDRLRIAAK
15290|gene|hbo      YQSYSAFAGNPLLVDLDQLREDGYLTDDDLE-PVPAFSDHEIEYDRVAEYKREQLRTAHE
                    * * ********::.*  *   *:*     . *        : ** * ::*   *  *  

1505|gene|hla       RFDEA--------------------------------------------EAGKAHSEFDA
1049|gene|hut       GFEAS--------------------------------------------AEADDRAAFEA
2468|gene|hhi       RFDES--------------------------------------------ASDADQQSFAE
11957|gene|hma      AFEES--------------------------------------------ASDADQQSFTK
2578|gene|hwa       RLQESVGGINIHADTDTTASSGVNDDIAVDVTVTLGDSVDPSQNISTHNQTSIDATAFKS
15290|gene|hbo      RFQSE--------------------------------------------ATTEDREAFDA
                     ::                                                      *  

1505|gene|hla       FREREP-WLDDYALFRAMSGERDDDTWVEWPDPLRTREPEALDEARERHATEVRFGEFLQ
1049|gene|hut       FREREATWLRDYTLFTALKAAYDGVPWPEWPADLAGRDPPALEAARETHAEAIRYHAFVQ
2468|gene|hhi       FCEREAGWLDDYALFTALKAEFDDAGWMDWPDDIRTREPAAVERYRDELADDIRYHKFVQ
11957|gene|hma      FCEREAGWLDDYALFTALKAEFDDAGWMDWPDDIRTREPAAMERYQDDLADDIRYHKFVQ
2578|gene|hwa       FYRRESHWLTDYALFMALRTSYDGA-WTDWPESIQHRDPDALSDQYESLDSEVIYHLIIQ
15290|gene|hbo      FREHESSWLDGYALFMALRTRYDGA-WTTWPQEIRTHDEAAINRHREELADEISYREFAQ
                    *  .*. ** .*:** *:    *.  *  **  :  .:  *:.   :     : :  : *

1505|gene|hla       WMFDRQWRDLRAVAADEGVSIVGDVPIYVALDSADVWANPEAFRLDEGNRPAVVAGVPPN
1049|gene|hut       WLFDEQWRALRAAADERGISLVGDLPIYVAWDSADVWANPEAFELDDEGGPTAVAGVPPN
2468|gene|hhi       WCFDSQWQALAEYAAERDIGLVGDLPIYVGLDSADVWAYPEVFRLDDDHHPAEVAGVPPN
11957|gene|hma      WCFDSQWQALADYAAERDIGLVGDLPIYVGLDSADVWAYPEVFRLDDDHHPAEVAGVPPN
2578|gene|hwa       FIFDQQWQSLQAAATDRDITLVGDLPIYVALDSADVWATPDVFQLTKDNEPAVVAGVPPS
15290|gene|hbo      FVFDTQWRELKAYANDHGVKLVGDLPIYVALDSADVWAAPEAFDLTEENEPVAVAGVPPN
                    : ** **. *   * : .: :***:****. ******* *:.* * .   *. ******.

1505|gene|hla       PGDDGQRWGNPVYDWDRLAERDYDWWIARFRRLFELADVARLDHFLGFVKYWAIPADADD
1049|gene|hut       PGDDGQRWGNPVYDWETLRAEDYGWWRDRLDRLLSLVDIARIDHFKAFDEYWAIPADADD
2468|gene|hhi       PGDDGQRWGNPVYDWDALRANDYGWWVDRFERLFDLVDIARIDHFKGFDEFWSIPAEADD
11957|gene|hma      PGDDGQRWGNPVYDWDALRANDYGWWVDRFERLFDLVDIARIDHFKGFDEFWSIPAEADD
2578|gene|hwa       DGDDGQRWGNPVYDWEHLRETEYNWWLHRLDRLFTLVDITRIDHFKGFDAYYAIPVDSDT
15290|gene|hbo      PNDDGQRWGNPLYDWDYLRENDYDWWMDRLERLFELVDVTRIDHFKGFDEYWAIPADAHS
                     .*********:***: *   :*.**  *: **: *.*::*:*** .*  :::**.::  

1505|gene|hla       PAAGEWCEGPGRDLFETVERELGQAPFIAEDLGFEEPAMDELMVEFGFPGMRVPQYADWC
1049|gene|hut       PAAGEWRPGPGADFFETIRAELGELPFVVEDLGFLDESMVALRDRFEFPGMRVPQYADWC
2468|gene|hhi       PAAGQWRDGPGAHFFETVRDRLGELPFFVEDLGFLDESIVALRDRFGFPGMRVPQYADWC
11957|gene|hma      PAAGQWRDGPGAHFFETVRDRLGELPFFVEDLGFLDESIVALRDEFGFPGMRVPQYADWC
2578|gene|hwa       PAAGEWHSVPGYDFFETIREHIGSLPFVVEDLGFIDQALHDLREHFNFPGMRVPHYADWC
15290|gene|hbo      PAAGEWRDAPGHDFFETVEDQFGDLPFIVEDLGFLDQRMTDLRDRFGFPGMRVPQYANWC
                    ****:*   **  :***:   :*. **..***** :  :  *   * *******:**:**

1505|gene|hla       AEGNQYQPMHYPEGVVGYTSTHDTDTWVGYFEGLPERQRDCFRYNVGADGDRPPEWEIID
1049|gene|hut       REGHRYKPTVYPDHCVGYTSTHDTDTAVGFYEKLSAEQRDCLEYALATDGD-SIAWDLIE
2468|gene|hhi       EEGHMYQPMHYPESAVGYTSTHDTDTIVGYYRDLADRQRDCLHYNLGTDGD-EINWDLIE
11957|gene|hma      EEGHMYQPMHYPESAVGYTSTHDTDTIVGYYRDLADRQRDCLHYNLGTDGD-EINWDLIE
2578|gene|hwa       HEGNMYQPMHYPAQSVAYSSTHDTNTIVGYYGSLSHSQRDCLHYNLGVDGS-EINWSIID
15290|gene|hbo      QEGDMYQPMHFPENSVGYTSTHDTNTFVGYYRDLPADQKDCLHYNIGADGS-EIHWSIID
                     **  *:*  :*   *.*:*****:* **::  *.  *.**: * :..**.    *.:*:

1505|gene|hla       EVWASEAVLAMTTVQDLLGLGSESRFNEPGTLNGNWEWRVRRDALDDAIADRLWDLAGRH
1049|gene|hut       AVWHSDAALAMTTVPDLLERGSDARLNQPGTGEGNWTWRVTADELDADTADRLAAVTRAS
2468|gene|hhi       AVWNSNAVVAMTTMQDLLGLDSDARFNVPGTATGNWQWRVTEDAINDEVAERLRQVTDRT
11957|gene|hma      AVWNSNAIVAMTTMQDLLGLGSDTRFNVPGTATGNWQWRVTDTALDADIAERLRRVTDRT
2578|gene|hwa       AVWRSDAQIGFTTLQDILGLDSHARFNEPGTASGNWQWRCTDSGLDDDLARRLAGLTIEH
15290|gene|hbo      AVWRSNAVIAFTTIQDILGLGAEARFNVPGTTDGNWRWRCTEEGFDEELASRLARLTDEH
                     ** *:* :.:**: *:*  .: :*:* ***  *** **     ::   * **  ::   

1505|gene|hla       VR-
1049|gene|hut       LR-
2468|gene|hhi       IR-
11957|gene|hma      IR-
2578|gene|hwa       VRD
15290|gene|hbo      IR-
                    :*