HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0156COG0443KOG0104 KOG0100 KOG0101 KOG0102 KOG0103arCOG03060Molecular chaperoneheat shock protein

HOG Organism Gene ID Name Annotation
cHOG0156 nrc1 VNG0491 dnaK heat shock protein
cHOG0156 hmu HMUK2846 Hmuk_2846 chaperone protein DnaK
cHOG0156 hma RRNAC3339 dnaK chaperone protein DnaK
cHOG0156 hwa HQ2640A dnaK dnaK-type molecular chaperone hsp70
cHOG0156 hla HLAC0682 Hlac_682 chaperone protein DnaK
cHOG0156 hbo HBOR16250 Hbor_16250 chaperone protein DnaK
cHOG0156 hut HUTA0310 Huta_0310 chaperone protein DnaK
cHOG0156 hvo HVO_1590 HVO_1590 dnaK chaperone protein DnaK
cHOG0156 nph NP0218A dnaK dnaK-type molecular chaperone hsp70
cHOG0156 hhi 1849 HAH_1849 hypothetical protein
cHOG0156 hhi 579 dnaK1 chaperone protein DnaK
cHOG0156 hhi 4198 dnaK2 chaperone protein DnaK
cHOG0156 hhi 4089 HAH_4089 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


4089|hp|hhi         MQIATKIWDSGWG---AVFLTV------------------------------YTGVA---
1849|hp|hhi         ----------------------------------------------------MVGQP---
4198|gene|hhi       MTLSNLPIGIDLGTTNSVVATVSDGGFEVVPNARGDKKTPSVVSYDQDSQSVFAGRQADN
491|gene|nrc1       -MASEKILGVDLGTTNSAFAVMEGSDPEIITNEEGDRTTPSIVAH-DDGEL-LVGKPAKN
2640|gene|hwa       -MASNKILGIDLGTTNSAFAVMEGDDPEIIVNAEGDRTTPSVVAMTDDEER-LVGKPAKN
16250|gene|hbo      -MASNKILGIDLGTTNSAFAVMEGGDPEIIVNAEGDRTTPSVVAFTDDDER-LVGKPAKN
682|gene|hla        -MASNKILGIDLGTTNSAFAVMEGDEPEIIANAEGDRTTPSVVAFADDGER-LVGKPAKN
218|gene|nph        -MASNKILGIDLGTTNSAFAVMEGGDPEIIVNSEGERTTPSVVAFTDDGER-LVGKPAKN
310|gene|hut        -MASNKILGIDLGTTNSAFAVMEGGDPEIIVNSEGDRTTPSVVAF-DDGEQ-LVGKPAKN
13339|gene|hma      -MASNKILGIDLGTTNSAFAVMEGGDPEIIVNGEGERTTPSVVAF-DDGER-LVGKPAKN
579|gene|hhi        -MASNKILGIDLGTTNSAFAVMEGGDPEIIVNGEGERTTPSVVAF-DDGER-LVGKPAKN
                                                                         .*     

4089|hp|hhi         ---------IQLVR------------------PEPLFLKTLSVLPTILVMFLADQQNNRL
1849|hp|hhi         ------------------------------------SAYIIKKLIHDVETVVGKVLEDRS
4198|gene|hhi       RAIHHPEKTVKSVKRHMGTDE-TFSLGPDQYHPEEISGLILKKLIEDAGNELNRPLSNAV
491|gene|nrc1       QAVQNPDQTIASIKRHMGEEDYTVALGDDEYTPEEISARILQKIKRDAEEYLGQDVEKAV
2640|gene|hwa       QVIQNPDQTIRSIKRHMGEEDYTVELGGEDYTPEQVSAMILQKIKRDAEEYLGDEIEKAV
16250|gene|hbo      QAIQNPDHTIRSIKRHMGEEDYTVEIDDEEYTPEQISAMTLQKIKRDAEDYLGDEVEKAV
682|gene|hla        QAVQNPDRTIQSIKRHMGEDGYTVEIGDEEYTPEQVSAMILQKIKRDAEEYLGDDVEKAV
218|gene|nph        QAVQNPEDTIQSIKRHMGEDDYTVEVGDDEYTPEQISAMILQKIKRDAEEYLGDDIEKAV
310|gene|hut        QAVKNPDETIQSIKRHMGEEDYTVSLDGEEYTPEQVSAMILQKIKRDAEEYLGDEIEKAV
13339|gene|hma      QAVKNPDETIQSIKRHMGEDDYSVELDGEEYTPEQVSAMILQKIKHDAEEYLGDEIEKAV
579|gene|hhi        QAVKNPDETIQSIKRHMGEDDYSVELDGEEYTPEQVSAMILQKIKHDAEEYLGDEIEKAV
                                                            :. :       :    ..  

4089|hp|hhi         INF--FAGGELRRSTDQIQKITGH------------------------------------
1849|hp|hhi         TEAAFWHPDRRAR-----------------------------------------------
4198|gene|hhi       ITVPAYFSDAQRRATKRAGEIAGIDVDRVLPEPTAACLAYGLQSTAGKRVLVYDLGGGTF
491|gene|nrc1       ITVPAYFNDRQRQATKDAGEIAGFDVERIVNEPTAASMAYGLDEDRDQTVLVYDLGGGTF
2640|gene|hwa       ITVPAYFNDRQRQATKDAGEIAGFEVDRIVNEPTAASMAYGLDDESNQTILVYDLGGGTF
16250|gene|hbo      ITVPAYFNDRQRQATKDAGEIAGFEVERIINEPTAASMAYGLDDDSDQTVLVYDLGGGTF
682|gene|hla        ITVPAYFNDKQRQATKDAGEIAGFEVERIVNEPTAASMAYGLDDESDQTVLVYDLGGGTF
218|gene|nph        ITVPAYFNDRQRQATKDAGEIAGFEVERIVNEPTAAAMAYGLDDESDQTVLVYDLGGGTF
310|gene|hut        ITVPAYFNDRQRQATKDAGEIAGFEVDRIVNEPTAASMAYGLDDESDQTVLVYDLGGGTF
13339|gene|hma      ITVPAYFNDRQRQATKDAGEIAGFEVERIVNEPTAAAMAYGLDDESDQTVLVYDLGGGTF
579|gene|hhi        ITVPAYFNDRQRQATKDAGEIAGFEVERIVNEPTAAAMAYGLDDESDQTVLVYDLGGGTF
                         :  .   .                                               

4089|hp|hhi         -------------------------DDFYESASEELQNRVDD--------FDRRAYQKNI
1849|hp|hhi         ------------------------------------------------R-----------
4198|gene|hhi       DCSAVKIDDGVIETLGVDGATDLGGDDYDSLIVNWVADTIADEYGSPPALNNPKVNQRLF
491|gene|nrc1       DVSILDLGGGVYEVAATNGDNDLGGDDWDHAIIDHLADNFENEHGIDLR-EDRQALQRLT
2640|gene|hwa       DVSVLDLGGGVYEVVATNGDNDLGGDDWDDAVIDWLAGEFEDNHGIDLR-DDRQALQRLK
16250|gene|hbo      DVSVLDLGGGVYEVVATNGDNDLGGDDWDQAIIDWLAEEFENNHGIDLR-EDRQALQRLK
682|gene|hla        DVSVLDLGGGVYEVVATNGDNDLGGDDWDEALIDHLAKEFKNNHGIDLR-EDRQALQRLK
218|gene|nph        DVSILDLGGGVYEVVATNGDNDLGGDDWDEAIIDYLADSFEEEHGIDLR-EDRQALQRLH
310|gene|hut        DVSILDLGGGVYEVVATNGDNDLGGDDWDRAIIDWLAEDFAEEHGIDLR-EDRQALQRLK
13339|gene|hma      DVSILDLGGGVYEVVATNGDNDLGGDDWDHAIIDYLADEFEAEHGIDLR-DDRQALQRLT
579|gene|hhi        DVSILDLGGGVYEVVATNGDNDLGGDDWDHAIIDYLADEFEAEHGIDLR-DDRQALQRLT
                                                                                

4089|hp|hhi         SILAGLIIALTT--------PFVG------------------------------------
1849|hp|hhi         ------------------------------------------------------------
4198|gene|hhi       GAAKEVKHELSSRTSAIHQLPFLELQNGDTIDYELNITRGEFAEITAGPTQETIDIMNGF
491|gene|nrc1       EAAEEAKIELSSRKETTVNLPFVTATDSGPVHLEQDITRATFESITEDLIERTVGPTEQA
2640|gene|hwa       DAAEEAKIELSSRKETTINLPFITATDSGPVHLEETLSRAKFESLTEDLIERTVGPTEQA
16250|gene|hbo      DAAEEAKIELSSRKETTINLPFITATDSGPVHLEEKLTRAKFESLTSDLIDRTVGPTEQA
682|gene|hla        DAAEEAKIELSSKKETTVNLPFITATDSGPVHLEQSITRATFENLTSDLIERTVNPTEQA
218|gene|nph        EAAEEAKIELSSRKETNINLPFIAATDEGPLNLEESISRAKFESLTSDLVERTVGPTEQA
310|gene|hut        DAAEEAKVELSSRKETEINLPFITSTDDGPVHLETDITRAKFESLTSDLIERTVEPTEQA
13339|gene|hma      EAAEEAKIELSSRKETRINLPFIATTDDGPLDLEQKITRAKFESLTEDLIERTVGPTEQA
579|gene|hhi        EAAEEAKIELSSRKETRINLPFIATTDDGPLDLEQKVTRAKFESLTEDLIERTVGPTEQA
                                                                                

4089|hp|hhi         --------------FYLGGT---------------------------FGLGIGLVIGLLA
1849|hp|hhi         ------------------------------------------------------------
4198|gene|hhi       LNDLGLTPSQFDDVLLVGGATRIPAIRSAVEQFFGQEPRTDLNPDQIVALGAATQAAILN
491|gene|nrc1       LEDAGLSKSDIDDVILVGGSTRMPQVQAQVEDLVGQEPKKNVNPDEAVALGAAVQGGVLS
2640|gene|hwa       LEDAGYDDSDIDEVILVGGSTRMPQVREKVEDLLGTEPKKNVNPDEAVALGAAIQGGVLA
16250|gene|hbo      LEDAGYTKEDIDDVILVGGSTRMPQVHEKVEEMLGIEPKKNVNPDEAVALGAAIQGGVLG
682|gene|hla        LSDADYSKSDIDEVILVGGSTRMPQVQEQVEALVGQEPKKNVNPDEAVALGAAVQGGVLS
218|gene|nph        LDDAGYSKGDIDEVILVGGSTRMPMVQEKVEELTGQEPKKNVNPDEAVGLGAAIQGGVLS
310|gene|hut        LEDADYSKSDIDEVLLVGGSTRMPQVQEKVEELTGQEPKKNVNPDEAVALGAAIQGGVLS
13339|gene|hma      LADADYTKSDIDEVILVGGSTRMPQVQDQVEEMTGQEPKKNVNPDEAVALGAAIQAGVLS
579|gene|hhi        LADADYTKSDIDEVILVGGSTRMPQVQDQVEEMTGQEPKKNVNPDEAVALGAAIQAGVLS
                                                                                

4089|hp|hhi         ------------------------------------TQL--------------LTRRSIQ
1849|hp|hhi         ------------------------------------------------------------
4198|gene|hhi       DIEVPAVSTTNIVPSTEVSQGEAAINEGSNPILIDALPRTLGVELQEPKTNDTYFQPLIQ
491|gene|nrc1       -------------------------GEVDDIVLVDVTPLSLGIEVK-----GGLFERLIE
2640|gene|hwa       -------------------------GDVDDIVLLDVTPLSLGIEVK-----GGLFERLID
16250|gene|hbo      -------------------------GEVDDIVLLDVTPLSLGIEVK-----GGLFERLIE
682|gene|hla        -------------------------GDVDDIVLLDVTPLSLGIEVK-----GGLFERLIE
218|gene|nph        -------------------------GDVDDIVLLDVTPLSLGIEVK-----GGLFERLID
310|gene|hut        -------------------------GDVDDIVLLDVTPLSLGVEVK-----GGLFERLIE
13339|gene|hma      -------------------------GDVDDIVLLDVTPLSLGVEVK-----GGLFERLID
579|gene|hhi        -------------------------GDVDDIVLLDVTPLSLGVEVK-----GGLFERLID
                                                                                

4089|hp|hhi         ELNRLAQNISEPYTAKYENQ----------------------------------------
1849|hp|hhi         ------------------------------------------------------------
4198|gene|hhi       SGESIPARAEINVTPVRAHQTKTRFTIYQGDEGTLEGNDEIGELVLGPYPPKELDEYSQR
491|gene|nrc1       KNTAIPTTASKVFTTAADNQTSVQIRVFQGEREIASENELLGDFHLTGIPPAPAGTPQIE
2640|gene|hwa       KNTTIPTEESKVFTTAAANQTSVNVRVFQGEREIAEENELLGEFQLAGIPPAPAGTPQIE
16250|gene|hbo      KNTTIPTEESKIFTTAADNQTSVQVRVFQGEREIAEENELLGEFQLTGIPPAPAGTPQIE
682|gene|hla        KNTTIPTEESKVFTTAADNQTSVNVRVFQGEREIAEENELLGAFQLSGIPPAPAGTPQIE
218|gene|nph        KNTTIPTEASKVFTTAADNQTSVNIRVFQGEREIAEENELLGAFQLTGIPPAPAGTPQIE
310|gene|hut        KNTTIPTEESKIFTTAAANQTSVQIRVFQGEREIAEENELLGAFMLQGIPPAPAGTPQIE
13339|gene|hma      KNTTIPTEESKIFTTAQDNQTQVQIRVFQGEREIAEENELLGAFALSGIPPAPAGTPQIE
579|gene|hhi        KNTTIPTEESKIFTTAQDNQTQVQIRVFQGEREIAEENELLGAFALSGIPPAPAGTPQIE
                                                                                

4089|hp|hhi         ------------------------------------------------------------
1849|hp|hhi         ------------------------------------------------------------
4198|gene|hhi       ATMEIDSDGIITFTAVS-------------------------------------------
491|gene|nrc1       VTFEIDADGIVNVEAEDQGSGNAESITIEGGAGLSDEQIDEMQEDAEAHAEEDEQRRRRI
2640|gene|hwa       VTFNIDENGIVNVEAEDQGSGNAESITIEGGAGLSDEEIEQMQEEAEAHAEEDERRRERI
16250|gene|hbo      VTFNIDENGIVNVEAEDKGSGNAESITIEGGAGLSDEEIEQMQEEAEQHAEEDEQRRERI
682|gene|hla        VSFNIDENGIVNVEAEDQGSGNAESITIEGGVGLSDEEIDQMQEEAEKHKEEDEARRERI
218|gene|nph        VTFNIDENGIVNVEAEDQGSGNKEDITIEGGVGLSDEEIEEMQEEAEKHAEEDEKRRERI
310|gene|hut        VTFSIDENGIVNVSAEDQGSGNSEEITIEGGVGLSDEEIEEMQEEAEEHAEEDQQRRERI
13339|gene|hma      VSFNIDENGIVNVEAEDKGSGNKEDITIEGGAGLSDDQIEEMQQEAEQHAEEDEQRRERI
579|gene|hhi        VSFNIDENGIVNVEAEDKGSGNKEDITIEGGAGLSDEQIEEMQQEAEQHAEEDEQRRERI
                                                                                

4089|hp|hhi         ------------------------------------------------------------
1849|hp|hhi         ------------------------------------------------------------
4198|gene|hhi       ----------------------------LDADVSDTTE-IETRFNREE------------
491|gene|nrc1       EARNEAETAIQRAESLLEENEELVDED-LEADVNDAIDDVQAVLDEDEPEIDALETATEE
2640|gene|hwa       EARNSAESAVQRAETLLEENEEDIDDD-LKESIEDEVESVEAVLEDEDATKEEIEDVTES
16250|gene|hbo      EARNEAESAVQRAETLLEENEEQVDDD-LRADIEAAMDDVEATLEDEDATKEELEDATEA
682|gene|hla        EARNEAETSIQRAETLLEENEEELDDDELVADIEAAIEDVEEVLEDEDADTDEIESATEA
218|gene|nph        EARNEAESTLQRAETLLDENEDAVDDD-LRADIEASMDDLREVVEDEDADTDELTEATEA
310|gene|hut        EARNEAESAIQRAETLLEENEDAVDDD-LREDIESEIEAVQETLDDDDATKEDYEQAVEA
13339|gene|hma      EARNEAEASVRRAETLLDENEEEIDED-LQSDIEAKIEDVEEVLEDEDATKEDYEAVTET
579|gene|hhi        EARNEAEASVRRAETLLDENEEEIDED-LQSDIEAKIEDVEEVLEDEDATKEDYEEVTET
                                                                                

4089|hp|hhi         ------------------------------------------------------------
1849|hp|hhi         ------------------------------------------------------------
4198|gene|hhi       ---------------------------------------------------------ETL
491|gene|nrc1       LSDTLQEIGKQAYQQQQDA--QAGAA------GGAG----------GMGGMGGMA--DGP
2640|gene|hwa       LSSELQEIGKQMYDAQQAA--AGAGA------GAAGAG-----AGAGPGGMGDMGDMGDM
16250|gene|hbo      LSKELQEIGKQMYQQQAQAQGAQAGA------GGAGPG--------GAGGMGGMG--GQG
682|gene|hla        LTEELQEIGKQMYEGQAAQ----AGP------GGAGGA-----AGAGPGGMGGMGGAAGP
218|gene|nph        LAEALQEIGKQMYQQQAGEGGAGAGAGAAGGMGGAGPG---GMGGAGPGGMGGAGP-GGM
310|gene|hut        LTESLQEIGKQMYDQAGAEGAAGAGA------AGAGAGGMGGMGGAGPAGAGGPA--GGP
13339|gene|hma      LSEELQEIGKQMYQDQAQQ--AAGGA------AGAGPG-----GAAGPGGAAGPG--GAA
579|gene|hhi        LSEELQEIGKQMYQDQAQQ--AAGGA------AGAGPG-----GAAGAGGAAGPG--GAA
                                                                                

4089|hp|hhi         ----------------------------------
1849|hp|hhi         ----------------------------------
4198|gene|hhi       GGTN----------------PDLPALHR------
491|gene|nrc1       GGAADAD-G----DDEEYVDADFEDVDEE-----
2640|gene|hwa       GGAAGSG-D----ADNEYVDADFEDVDDDTKDE-
16250|gene|hbo      GQSPGDD--------DEYVDADFEDVDEDDEDA-
682|gene|hla        GGAGGAGPGGADADDEEYVDADFEDVDDEDDA--
218|gene|nph        GGAGPGAGAGQQGDGEEFVDADFEDVDDEDDEDE
310|gene|hut        GGAGDEA-------GEEYVDADFEEVQDEDDEDE
13339|gene|hma      GGAAEQG--------EEYVDADFEDVEESDEDE-
579|gene|hhi        GGAAEQG--------EEYVDADFEDVDDEDED--