HOG Organism Gene ID Name Annotation
aHOG1554 hhi 2686 HAH_2686 hypothetical protein
aHOG1554 hbo HBOR03800 Hbor_03800 hypothetical protein
aHOG1554 hla HLAC2129 Hlac_2129 hypothetical protein
aHOG1554 hmu HMUK0254 Hmuk_0254 conserved hypothetical protein
aHOG1554 hwa HQ1071 hypothetical protein
aHOG1554 nrc1 VNG0738 vng738 no entry
MUSCLE (3.6) multiple sequence alignment


738|hp|nrc1      MTERV--THETVQSGRGSVVRAGGTRRLAVQVPADSAA------------SLPVGDVVRV
2686|hp|hhi      MPDRVPSDHETVETHRVPVESVGRTDRPRVVLPDELDF--------------DDGDTVRL
2129|hp|hla      -MPRVPSDDEGVASIRVSLARSGGTRRPCVRIPNDDELDGRVESGTCESLSLAAGDVIRV
1071|hp|hwa      MAGRLPSDHDQVQSYRASLIRSGRIRRPCLQLPTEITL--------------TEDEVIRL
3800|hp|hbo      MSERVPSDHDSVMSYRATIARSGGTRRPCLRLPDEVTA-------------VEDGDIIRL
                    *:    : * : * .:   *   *  : :* :                   .: :*:

738|hp|nrc1      VLDGSEHHASVAATADDTPVVRGAYATPRLARQPNGADNELAAWLADAGLEAGRSVHVDV
2686|hp|hhi      ALDGDRYHAVVETNLDGEPVLSHVADNRRLARER-DGTNRLAEWVADGEVSLGGSAHLDV
2129|hp|hla      AIDREEYHAPVR-SDSEGRIIRGAFDNRRLAREPGEGANRLAEWLDENDREPGDVIVLDV
1071|hp|hwa      LLDEQQTHARISITAADEQVIRGAFKNSRVAQAPGEGENLLEGWCEKHDLQIGDAVEVDV
3800|hp|hbo      SLGGELFHARVT-ADSSSRLLRGAYDNKRLARTPGEGTNRLVEWCEATSRDPGSAVEFDE
                  :. .  ** :        ::  .  . *:*.    . * *  *      . *    .* 

738|hp|nrc1      VAAGFKYGLRAPGETATYESTGTPDEGLADIAASLGDGDGA
2686|hp|hhi      VTDGTEYGLRTPGKRVVYTATGGPDASLSDIARNLDN----
2129|hp|hla      VVPGELYGLRIPGERTVYEANRGPRSSLSDIARDLDG----
1071|hp|hwa      LDAGFCYGLRSPGDRVVYSVPSRPNASLHSIARNLDQDTTE
3800|hp|hbo      LDAGFCYGLREPGKRTVYSVPSRPNESLANIAEKFTRDE--
                 :  *  **** **. ..*     *  .* .** .: