HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0155COG0719arCOG01715ABC-type transport system involved in Fe-S cluster assembly permease componenthypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0155 nrc1 VNG0527 vng527 no entry
cHOG0155 hmu HMUK2920 Hmuk_2920 SufBD protein
cHOG0155 hma RRNAC1828 hypothetical protein
cHOG0155 hwa HQ1708A sufB ABC-type transport system involved in Fe-S cluster assembly, permease protein II
cHOG0155 hla HLAC0174 Hlac_174 SufBD protein
cHOG0155 hbo HBOR23580 Hbor_23580 ABC-type transport system involved in Fe-S cluster assembly, permease component
cHOG0155 hut HUTA0378 Huta_0378 SufBD protein
cHOG0155 hvo HVO_0861 HVO_0861 sufB/sufD domain protein
cHOG0155 nph NP1500A abc31p_2 Fe-S cluster assembly protein ABC transporter permease
cHOG0155 hhi 2353 sufD FeS assembly ATPase SufD
MUSCLE (3.6) multiple sequence alignment


174|gene|hla        MSTKAIESLSEDTVRRIAEERDEPEWLLETRLNALSALETADLPDVIQTPGRRWTDLEAL
1708|gene|hwa       MSTQLPADLSADTVREISSRRDEPEWLLQTRLEALESLESLDLPDVIKTPGRRWTDLESL
23580|gene|hbo      MSAQLPANLSEETVREISEQRDEPEWLLETRLSALAALDDIELPDVIQTPGRRWTNLEAL
527|chp|nrc1        MSTQLHTDISAETVRRIADERDEPAWLRETRLDALEALDDLAFPSVIETPGRKWTTLEDL
1500|gene|nph       MSTQVHASIDEATVRQISDELDEPEWLLETRLEALEALEELPFPDVIQTPGRKWTNLEDL
378|gene|hut        MSTQVRATVTADDVEQISAELGEPEWLTETRLEAFEALADLDMPSVIRTPGRDWTNLDAL
11828|hp|hma        MSTQVHANLTEAQVEQISDDLGEPEWLLETRKDALAALEELDMPDVIRTPGRTWTNLDAL
2353|gene|hhi       MSTQVHANLTEAQVEQISDDLGEPEWLLETRKDALAALEELDMPDVIRTPGRTWTNLDAL
                    **::    :    *  *:   .** ** :** .*: :*    :*.** **** ** *: *

174|gene|hla        DFEALVDPLNQSDTTERSAGDDDVVILPFSEAF--DEYGDIIEANFGSVLDPEHNYLTAL
1708|gene|hwa       DFETLVDPLNQSDETSR-VTAEGVKVLPFAEAV--DTHSDVVESAFGSTVAFDENYLTAL
23580|gene|hbo      DFEDLVDPLNQSDETER-VTDEGVHVLSFTEAF--DEFGDVLEANFGQTVDPESNYLTAL
527|chp|nrc1        DFDALVDPLSQTEDKDQ-VGAENARVESFHDALQDDDLADRVEDAFGSVIDPHQNRLTAL
1500|gene|nph       DYEVLVDPLDAAEEKDQ-VGPDTVDVLPFAEAV--DEHGDLLEEHFGSVVDPETNYLTAL
378|gene|hut        DYESLVDPLAFEEEKDR-IEAEGVDVLPWAEAL--EEHGDLIEEHFGSVVDPQRDYLTAL
11828|hp|hma        EYESLVDPLDYAQDKDR-VDAEGVEVLSWSEAL--ADHEDLVKEHFGSTVDPQRDYLTAL
2353|gene|hhi       EYESLVDPLDYAQDKDR-VDAEGVEVLSWSEAL--DEHADLVKEHFGSTVDPQRDYLTAL
                    ::: *****   : ...    : . : .: :*.      * ::  **..:    : ****

174|gene|hla        SVALFTTGTFVYVPEGVDVEDVTVRAEMNSRSLFSQTLVVAEESSSVTILESIESGDDGV
1708|gene|hwa       STALFTTGTVVYVPEGVDAEDVKVRAEMNSRSLFSHTLVISEPSSSVTILESIEPGSASV
23580|gene|hbo      STALFTTGTFIYVPEGVDAEDVKVRAEMNSKSLFSHTLVVTEESSSVTILERIDSGASA-
527|chp|nrc1        STALFTTGTVVYVPAGVDAEDVTIRTSMNSRSLFNYTLVITEDNATATILERQDTGDDV-
1500|gene|nph       STALFTTGTVVYVPEGTDAEDVTIRTKMNSRSLFNYTLVVAEESSSVTILERQESGDEV-
378|gene|hut        STALFSAGTVVYVPEGVAAEDVKIRTRMNSRSLFNYTLVITEESASVTILERQETGEEL-
11828|hp|hma        STALFSAGTVVYVPEGVDAEDVKIRTTMNSQSLFNYTLVLAEESSSVTILERQQTGETT-
2353|gene|hhi       STALFSAGTVVYVPEGVDAEDVKIRTTMNSQSLFNYTLVLAEESSSVTILERQQTGETT-
                    *.***::**.:*** *. .***.:*: ***.***. ***::* .::.****  :.*    

174|gene|hla        DGD-RYFSNLVEIVAGENANVQFGSLQNLDDDSYTYSLKRGVTDTYATVDWIESNFGSKL
1708|gene|hwa       DVDSRYFSNLVEIAAGENSYVQYGSLQTLEDNTYSYTLKRADVSTYGTVNWIEGNLGSRL
23580|gene|hbo      EGA-RYFSNLVEIATGENSYVQYGSLQNLDEDTYHYTLKRGDADVYGTINWIEGNIGSRL
527|chp|nrc1        DGE-RYYSGIVEVDAGENSYVQYGSLQDFDEQTYNYTLKRGHADTYATVNWIEGNIGSRL
1500|gene|nph       DGN-RYYSGLTEVVAGENSYVQFGNLQDLDQTTYTYSLKEAAIDTYGNVNWIECNIGSKL
378|gene|hut        PGE-QYYSGVVEVVASENSHVQYGSLQNLSEATYNYSVKRGHADQYATVDWIEGNIGSRL
11828|hp|hma        DAD-QYYSGIVEVVAEENAYVQYGALQNLSEETYNFQVKRGHADTYATVNWIDGNIGSRL
2353|gene|hhi       DAD-QYYSGIVEVVAEENAYVQYGALQNLSEETYNFQVKRGHADTYATVNWIDGNIGSRL
                        .*:*.:.*: : **: **:* ** :.: :* : :* .  . *..::**: *:**.*

174|gene|hla        TRSDVETELNGDGSESQIVGTFFGTEDQHFDINARVWHQAEHTTADLVTRGVLDDVSRSV
1708|gene|hwa       TRSDVESNLNGDSSESQIVGAFFGHEDQHFDVNARVWHMAEHTTADLVTRGVLDDEARSV
23580|gene|hbo      TRSDVETELNGDSSETQIVGAFFGHEDQHLDLNARVWHNAENTTADLVTRGVLDDDARSV
527|chp|nrc1        TKTGVSTELAGDASETKIVGAFFGHDDQHFDLDAKVWHRAEHTTADLVTRGVIDDDARSV
1500|gene|nph       TKSSVESYLDGDSSESKIVGAFYGHDDQHLDIDARVWHTAEHTTADLVTRGVIDDEARSV
378|gene|hut        TKTNVETRLLGDSSESQIVGAFFGHEDQHLDIASRVWHEAEHTTADLVTRGVLDDEARSV
11828|hp|hma        TKSNVETRLLGDSSESQILGAFFGHEDQHFDIASRVWHEAEHTIADLVTRGVLDDDARSV
2353|gene|hhi       TKSNVETRLLGDSSESQILGAFFGHEDQHFDIASRVWHEAEHTIADLVTRGVLDDDARSV
                    *.:.*.: * **.**::*:*:*:* :***:*: :.*** **:* ********:** :***

174|gene|hla        YEGVQDVGEDAWNTSSYQRENTLMLSDDAEADASPKLIIHNHDTEASHSATVGQVDAEDL
1708|gene|hwa       YEGVQDVGRDAWSTSSYQRENTLMLSDESEADASPKLIINNHDTEASHSATVGQVNEEDL
23580|gene|hbo      YEGVQDVGRDAWNTSSYQRENTLMLSDESEADASPKLIIHNHDTEASHSATVGQVDKEDL
527|chp|nrc1        YEGVQDVGSDAWDTSSYQRENTLMLSDESEADASPKLIINNHDTEASHSATVGQVDQETL
1500|gene|nph       YEGVQDVGADAWDTNSYQRENTLMLSDESEADASPKLIINNHDTEASHSATVGQVSAEEM
378|gene|hut        YEGVQDVGTDAWDTSSYQRENTLMLSDDSEADASPKLIINNHDTEASHSATVGQVDAEDL
11828|hp|hma        YEGVQDVGREAWDTSSYQRENTLMLSDDSEADASPKLIINNHDTEASHSATVGQVDAEDM
2353|gene|hhi       YEGVQDVGREAWDTSSYQRENTLMLSDDSEADASPKLIINNHDTEASHSATVGQVDEEDM
                    ******** :**.*.************::**********:***************. * :

174|gene|hla        FYLESRTIDPLTARNMLVEGFFVPVLEEIAVDEFRDDVQELVLQRLQ---
1708|gene|hwa       FYMTSRAIDPGVARDMLVEGFFVPVLEEIAVDEFRDDLQQLISDRLE---
23580|gene|hbo      FYMISRSVPQLQARNMLVEGFFVPVLDEIAVDEFREDLEELISARLR---
527|chp|nrc1        FYMQDRGLTAQQATDMLVAGFFVPVLEEVEVQELREDLETRIAERLD---
1500|gene|nph       FYMTSRALPERLAKNMLVEGFYVPVLEEIEVEELREELKGRVRGRLQARA
378|gene|hut        FYMTSRGVDEESATNMLVEGFFVPVLEEVAVDELREDLDELVVDRLAE--
11828|hp|hma        FYMTSRGVDPESAKNMLVEGFFVPVLEEVEVDELREDLDQLIYERLRQ--
2353|gene|hhi       FYMTSRGVDPERAKNMLVEGFYVPVLEEVQVDELREDLDQLIYERLRE--
                    **: .* :    * :*** **:****:*: *:*:*:::.  :  **