HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0154COG0092KOG3181arCOG04097/1Ribosomal protein S330S ribosomal protein S3P

HOG Organism Gene ID Name Annotation
cHOG0154 nrc1 VNG1697 rps3p 30S ribosomal protein S3P
cHOG0154 hmu HMUK1834 Hmuk_1834 ribosomal protein S3
cHOG0154 hma RRNAC1605 rps3p 30S ribosomal protein S3P
cHOG0154 hwa HQ2836A rps3p 30S ribosomal protein S3P
cHOG0154 hla HLAC2443 Hlac_2443 ribosomal protein S3
cHOG0154 hbo HBOR10290 Hbor_10290 SSU ribosomal protein S3P
cHOG0154 hut HUTA2298 Huta_2298 ribosomal protein S3
cHOG0154 hvo HVO_2558 HVO_2558 30S ribosomal protein S3P
cHOG0154 nph NP4866A rps3p 30S ribosomal protein S3P
cHOG0154 hhi 2148 rps3p 30S ribosomal protein S3P
MUSCLE (3.6) multiple sequence alignment


1697|gene|nrc1      MADELEFIEQGLQRSQIDEFFAEELARAGYGGMELAPTPMGMQIVLKAEKPGMVIGKGGK
2836|gene|hwa       MADEHQFIENGLQRSQIDEFFADELGRAGYGGMDVAKTPMGTQIVLKAEKPGMVIGKGGK
2443|gene|hla       MADEHQFIEDGLRRSQINEFFADELGRAGYGGMDVAKTPMGTQIVLKAEKPGMVIGKGGK
10290|gene|hbo      MADEHQFIENGLQRSQIDEFFAEELGRAGYGGMDVAKTPMGTQIVLKAEKPGMVIGKGGK
4866|gene|nph       MADEHQFIHDGLQRTQIDEFFSEELSRAGYGGMEVAKTPMGTQIVLKAEKPGMVIGKGGK
2298|gene|hut       MADELQFIQDGIQRTQIDEFFEDELGRAGYGGMDVAKTPMGTQIVLKAEKPGMVIGKGGK
11605|gene|hma      MADEQQFIEDGLQRTQIDEFFAEELGRAGYGGMDVAKTPMGTQIVLKAEKPGMVIGKGGK
2148|gene|hhi       MADEQQFIEDGLQRTQIDEFFAEELGRAGYGGMDVAKTPMGTQIVLKAEKPGMVIGKGGK
                    **** :** :*:.*:**:*** :**.*******::* **** ******************

1697|gene|nrc1      NIRKITTQLEERFDLEDPQIDVQEVEEPDLNAQIVADRLANALERGWYFRKAGHTTIDRI
2836|gene|hwa       NIRKVTRELEDRFNLDDPQIDVQEVDEPDLNARIVADRLANALERGWYFRKAGHTTIDRI
2443|gene|hla       NIRKITTELEDRFDMDDPQIDVQEVDEPDLNAQIVADRLANALERGWYFRKAGHTTIDRI
10290|gene|hbo      NIRKVTKALETRFNLEDPQIDVQEVDEPDLNARIVADRLANALERGWYFRKAGHTTIDRI
4866|gene|nph       NIRKITTTLEEEFGLEDPQVDVQEVDEPDLNAQIVADRLANALERGWYFRKAGHTTIDRI
2298|gene|hut       NIRKITTTLEEEFGLEDPQVDVQEVEEPDLNARIVADRLANALERGWYFRKAGHTTIDRI
11605|gene|hma      NIRKITTELEDRFNLDDPQVDVQEVDEPDLNARIVADRLANALERGWYFRKAGHTTIDRI
2148|gene|hhi       NIRKITTELEDRFNLDDPQVDVQEVDEPDLNARIVADRLANALERGWYFRKAGHTTIDRI
                    ****:*  **  *.::***:*****:******.***************************

1697|gene|nrc1      MESGALGAEIVLSGKVTGNRGRVEKFNRGYIKHNGEPAEEIVDHGKGVAVMKLGTIGVNV
2836|gene|hwa       IESGALGAEIVLSGKVTGARSRVEKFNRGYIKHNGEPAQEIVDEGQGVAVMKLGTIGVTV
2443|gene|hla       MDAGALGAEIVLSGKVTGARSRVEKFNRGYIKHNGEPAQEVVDHGQGVAVMKLGTIGVNV
10290|gene|hbo      MDAGALGAEIVLSGKVTGARSRVEKFNRGYIKHNGEPAQEIVDEGQGVAVMKLGTIGVTV
4866|gene|nph       MESGALGAEIILSGKVTGARSRVEKFNRGYIKHNGEPAESIVDSGVGTAVMKLGTIGVQV
2298|gene|hut       MESGAKGAEIVLSGKVTGARSRVEKFNRGYIKHNGEPAEDIVDHGQGVAVMKLGTIGVDV
11605|gene|hma      MESGALGAEIVLSGKVTGARSRVEKFNRGYVKHNGEPAEEIVDSGVGVAVMKLGTIGVRV
2148|gene|hhi       MESGALGAEIVLSGKVTGARSRVEKFNRGYVKHNGEPAEEIVDSGVGVAVMKLGTIGVRV
                    :::** ****:******* *.*********:*******:.:** * *.********** *

1697|gene|nrc1      KIIPPNAELPDDFEIQEDADIEDLVVDE--AEAGEDLEELLEGEDAD---AEDADADAAA
2836|gene|hwa       KIIPPGAELPDDFEIHDDVDVEPVEQVA----ESDGVDSLLAEDPADIP-DVGAD-DDVT
2443|gene|hla       KIIPPGAQLPDDFDIREDADVPEVEQAAVDVDADEGVESLLEEEPEEVP-DVGAD-DDVE
10290|gene|hbo      KIIPPGAKLPDDFEIEEDADVEPVEQAV----ESEGVEELLEDEPEEIP-DVAADQEEVE
4866|gene|nph       KIIPPEAELPDDFEVYEDIEVEDFVEEP----EGD-VEELLEA-PEDAE-AESVGADPEE
2298|gene|hut       KIIPPNAELPDDFEIYEDVEVEDYVEDV----EEGSVEELLAGEPEEGDAAEAADADAAD
11605|gene|hma      KIIPPNAELPDDFEIYEDVDVEDYVADT----DGESVEELLEGEPEDSETAEELDEDVAA
2148|gene|hhi       KIIPPDAELPDDFEIYEDVDVEDYVADT----DGESVEELLEGEPEDSETAEELEEDVAA
                    ***** *:*****:: :* ::               ::.**     :         :   

1697|gene|nrc1      EPESEPADFEDEEVI---------------ETDDDVEEELDEL------ADAVEGEDE--
2836|gene|hwa       VPQETPEEIIDEEVVEADPGVSSEDEEVVTEPV-DIGGDDEDVEDIEVVSDDSGNDTETV
2443|gene|hla       IPDEDPAEAIDEEVV----------EEVVEETQ-DTATEATDVA-----AEEPVGDAE--
10290|gene|hbo      VPDEEPSEVIDEEIV----------EEVVEESG-DVESDAE--------TDESEDDEE--
4866|gene|nph       VIEEETEAEAVEEVA---------EEEIIDEE--GVEAETGDAP-----TS-PPDAAE--
2298|gene|hut       AADDAAEDAPDEEVV---------EEAAEAEEFDDVDVPDDAGV-----ED-ELDELE--
11605|gene|hma      GADDDSE--ADEEFV---------DEEIVEE---DVEVPTDDDV-----EDVDVDELE--
2148|gene|hhi       GADDAEA---DEEFV---------DEEIVEE---DVEVPTDDDV-----EDVDVDELE--
                      :.       **.                *   .               .   .  *  

1697|gene|nrc1      DDEFSDVDDEAADTAEDLLDEMDDEDGGAE-----------------
2836|gene|hwa       AEEVEELDAEVEAEAEDLVAEMEDIDEEDV-----------------
2443|gene|hla       ADDIDELDEEIESEAADLVAEMEAADEDEEDE---------------
10290|gene|hbo      PADEAELDEEVEAEAEDLVAEMEAADEDEDDEETEE-----------
4866|gene|nph       EP-DEALDEDVEAEAEELLDEMEDETTDEEET---------------
2298|gene|hut       ESVDEELDEETEEAAEELLDEMDDEEADADDGDATADADADEEGEAE
11605|gene|hma      EAVDEELDEDVEAEAEELMDEM-DEEGDDE-----------------
2148|gene|hhi       DAVDEELDEDVEAEAEELMDEMDDEEADDE-----------------
                          :* :    * :*: **