HOG Organism Gene ID Name Annotation
aHOG1538 hhi 902 mntH1 Mn2+/Fe2 transporter, NRAMP family
aHOG1538 hbo HBOR30600 Hbor_30600 Mn2+/Fe2_ transporter, NRAMP family
aHOG1538 hmu HMUK1353 Hmuk_1353 natural resistance-associated macrophage protein
aHOG1538 hut HUTA2242 Huta_2242 natural resistance-associated macrophage protein
aHOG1538 hwa HQ1954 mntH manganese transporter NRAMP
aHOG1538 hma Hma_10151 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


1954|gene|hwa       --------------------MSQSTGKQHSLSEKISQLGPTWLAGAIAAGPASMASLLSG
30600|gene|hbo      ----------------MSEMTGETGVQSGTARGYLSEMGPSWVAGAIAAGPASMASLITA
2242|gene|hut       --------------------MATSRDASGTVKTYLQEMGPSWVAGAIAAGPATMASLIAA
902|gene|hhi        --------------MSSTETVDSSAVSKGTLGEYAEAMGPSWIAGAIAAGPATIASLVTA
10151|hp|hma        MSAVFSGGLTQAGGMSSTETVDSSAVSSGTISDYVEAMGPSWIAGAIAAGPATIASLVTA
                                           :   . :     . :**:*:*********::***::.

1954|gene|hwa       GANFGYALLWVVVISAIFGALAQYLATKLALETNEGLIKTVERRLGTKWAWLLVADVVLV
30600|gene|hbo      GAGFGYSLLWVVLLSAVAGTVAQYLAMRLGLLSGQGIVTLVESYLGESWAWILVVDVVVA
2242|gene|hut       GAGYGYDLLWVVVLSAFAGALAQYLAMRLGLLTERGIVGVVEDHLGESWAWILVLDAVIA
902|gene|hhi        GGAFGYSLLWVVVLSAGAGALAQYLAMRLGLLTERGIVAVVEEHLGDAWAWLLVGDAVLA
10151|hp|hma        GGAFGYSLLWVVVLSAGAGALAQYLAMRLGLLTERGIVAVVEDHLGETWAWLLVGDAVLA
                    *. :** *****::**  *::***** .*.* :  *::  **  **  ***:** *.*:.

1954|gene|hwa       AGFAQLVIMKTVASVSGLLMPFGAESWGVIWAVFLTVGLAGGGYRIAEIGAKVVVTGVVL
30600|gene|hbo      AGVAQLVIMKTVASVSATITGIDARIWGVIWAVILLAGLAGRGYRFLELAAKALVAAVVL
2242|gene|hut       AGVAQLVIMNTVASVSATITGLDAGIWGIIWAVILAVGLAGSGYRFVELFAKVLVSAVVL
902|gene|hhi        AGVAQLVIMKTVATVSATVTGIDARIWGVAWALVLAAGLAGGGYRFLELAAKVLVLLVVV
10151|hp|hma        AGVAQLVIMKTVATVSATVTGIDARIWGVVWALILAAGLAGGGYRFLELAAKILVLLVVV
                    **.******:***:**. :  :.*  **: **:.* .**** ***: *: ** :*  **:

1954|gene|hwa       AFIASLFVVPIDSGAAVSGLFPTVPIGGAIAAAGIVGGAVHVTIITMQTYTVKARGWTQS
30600|gene|hbo      AFVASAFIVPIDAGSAVQGLIPTLPSNGALVAAGILGGAVHITLITMHSYTMRARGWDES
2242|gene|hut       AFVASVFVVPIDPAAAASGLVPSVPGGSAAVAAAVLGGAVHITLITMHSYTMRAREWTAD
902|gene|hhi        AFVASLFVVPIDAGAAVNGLVPSVPSGSALVAAGILGGAVHITLITMHSYTMRARGWTRE
10151|hp|hma        AFVASLFVVPIDAGAAVAGLVPSVPSGSALVAAGILGGAVHITLITMHSYTMRARGWTRE
                    **:** *:****..:*. **.*::* ..* .**.::*****:*:***::**:.** *  .

1954|gene|hwa       DADIARFDISVSMLVAFGVFSIATFLVAAGALFGNIDAQGLQAIGAAQALEPIAGSFAQR
30600|gene|hbo      DYGLATFDVIASMLVAFGIYSISIFLVAASVL----SDPNLTTVGAAQALGPLVGPNAKW
2242|gene|hut       EYDLATFDVGISMLVAFGIYSVAIFLVTASVL----SDPNLSTVGAAEALGPLVGERAEV
902|gene|hhi        DYDLATVDVGASMLVAFGVYSLAIFLVTASVL----TSGDLTTVGAAEALGPLVGDSARW
10151|hp|hma        DYDLATVDVGASMLVAFGIYSLAIFLVTASVL----TSGDLTTVGAAEALGPLVGDSARW
                    : .:* .*:  *******::*:: ***:*..*       .* ::***:** *:.*  *  

1954|gene|hwa       VFLIGLLGAAVSTLGGNTLVPVYVIADKLTWETNVEDTRYRVLLAGTALVSGAGVFIPGA
30600|gene|hbo      LFLLGLGGAAVSTLGGNTIVPPFVVADKLGWGTTVEDSRYRALLAAFALLSAPGAFIGGQ
2242|gene|hut       LFLLGLGGAAVSTLGGNTIVPPFLLADKLGWGTTVEDSRYRGLLAAFALLSAPGAFIGGE
902|gene|hhi        LFLLGLWGAAVSTLGGNTIVPPFLLADKLGWGTTIEDNRYRGLLAAVALLSAPGAFIGGN
10151|hp|hma        LFLLGLWGAAVSTLGGNTIVPPFLLADKLGWGTTIEDNRYRGLLAAVALLSAPGAFIGGN
                    :**:** ***********:** :::**** * *.:**.*** ***. **:*..*.** * 

1954|gene|hwa       FLGQLVLVLAVGTVGTPFALALVLVLLNDSQTTGDPPSVAINIGGIAVFSVASILAGNFV
30600|gene|hbo      VIGQLVLVLALGTVGTPFAIAVVLYLLN-SEAVPKSNATLANAGGVGILLVSGALAANFV
2242|gene|hut       VLGQLVLVLAIGTVGTPFAIAVVLYLLN-SGAVPRVNSLPANLAGVALLAVTGGLAANFL
902|gene|hhi        VLGQLVLVLALGTVGTPFVIALVLYLLN-SDAVPESNSLAANAGGLALIAVSGGLAGNFV
10151|hp|hma        VLGQLVLVLALGTVGTPFAIALVLYLLN-SAAVPESNSLLANVGGLALIAVSGGLAANFV
                    .:********:*******.:*:** *** * :.    :   * .*:.:: *:. **.**:

1954|gene|hwa       ISQ---------ITSGLTLLSGSVLLFAAVILFATILLIGSHLRAQLGDASTTAISE
30600|gene|hbo      RGQ---------IAGGVELLSGAVLAFAVILGVAIVVLLGKYVREEVSVA-------
2242|gene|hut       RETATIEFFREATAGNVDVLTAAVLSFGVILSIATLGLLVKFFQERVAGTVP-----
902|gene|hhi        VEQ---------LGGGVGPLSGFVLAFAIVLGLAMAGLGGKFLREELLA--------
10151|hp|hma        VEQ---------LGGGVGPLSGFVLAFAIALGLAMAGLGGKFLREELLA--------
                                  ..:  *:. ** *.  : .*   *  ....  :