HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0153COG1413KOG0567arCOG04653FOG: HEAT repeathypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0153 nrc1 VNG0782 vng782 no entry
cHOG0153 hmu HMUK1905 Hmuk_1905 PBS lyase HEAT domain protein repeat-containing protein
cHOG0153 hma RRNAC1443 hypothetical protein
cHOG0153 hwa HQ1584A homolog to phycocyanobilin lyase subunit
cHOG0153 hla HLAC2402 Hlac_2402 PBS lyase HEAT domain protein repeat-containing protein
cHOG0153 hbo HBOR21990 Hbor_21990 PBS lyase HEAT-like repeat protein
cHOG0153 hut HUTA0719 Huta_0719 PBS lyase HEAT domain protein repeat-containing protein
cHOG0153 hvo HVO_1020 HVO_1020 PBS lyase HEAT-like repeat domain protein
cHOG0153 nph NP3228A homolog 2 to phycocyanobilin lyase subunit
cHOG0153 hhi 2024 HAH_2024 PBS lyase HEAT domain-containing protein repeat-containing protein
cHOG0153 hhi 4401 HAH_4401 PglZ domain-containing protein
MUSCLE (3.6) multiple sequence alignment


4401|gene|hhi       -----------------------------------MQAKQTLPEAAKDTIR-----KKFD
782|hp|nrc1         -----------------------------------------MSDGDEEPAE-----TTEE
2402|gene|hla       --------------------------------MDYARSSWCMSNGDDDPADASGEADAAD
1584|gene|hwa       -----------------------------------------MSDEDDET-------AADD
21990|gene|hbo      -----------------------------------------MSDGDDETPD-----ETSE
1020|gene|hvo       -----------------------------------------MSDGDDDT-----------
3228|gene|nph       -----------------------------------------MSNGDDESTE-----DAPD
719|gene|hut        -----------------------------------------MTNGDDDAEP-----DGTD
11443|hp|hma        MLATHGTATPDTYSLLVGPAAAGPARLERKTLLARSDTVLDMSNGDDEA-------DASD
2024|gene|hhi       -----------------------------------------MSNGDDDA-------DASD
                                                             :.:  .:.           

4401|gene|hhi       RAESADPIVLWWDDGNYLEDIIEQACDELGVHLKVAEETPLELRANPVDGEQVWYVPHVK
782|hp|nrc1         AGEAADT--------------TAVDPDTLESRLDDAEAAL--------------------
2402|gene|hla       DAEEAGGAGESTDAAAAPTLPDEATEESLNEYLDEIAERL--------------------
1584|gene|hwa       APESETS--------------IAVTPESVISRLDDVESAL--------------------
21990|gene|hbo      KSETAAASES-----------DEITAESLDERLDSAEEDL--------------------
1020|gene|hvo       ---------------------TELSPESFDERLTEAEEAL--------------------
3228|gene|nph       EAASDGED-------------PDISIEEFETRLDDIEAAL--------------------
719|gene|hut        GASGDG---------------AELGVEDFEGRLDDAEDTL--------------------
11443|hp|hma        DAEATDE--------------IDVTAEELESRLTEAGDAL--------------------
2024|gene|hhi       DAEAADE--------------IDVTAEELESRLTEASDAL--------------------
                                              : .   *                           

4401|gene|hhi       EPEDAEGDFDWFRDVEHTGGDVEMSIEDLTVHAFERGQLDAWELKTATQADDPTKRREIA
782|hp|nrc1         EAASTESDLD----------DIEASLDAVA------ADIEAAEL--PEPDDDDEE--SRE
2402|gene|hla       DDAETEADLD----------DIDALLDDAE------DGLDEADL--PEPDEDDEDADDPR
1584|gene|hwa       DAAETESALD----------EVETTLATIT------DDLEASTL--PEPDGDDEE--DPT
21990|gene|hbo      DAAETESDLD----------EVESTLDAVE------SDLDAADL--PEPDEDDEDAEDPR
1020|gene|hvo       DAAETEADLD----------EVEATLDDIE------ADVEAADL--PEPDDEDED--DPA
3228|gene|nph       EDASTEDDLD----------AVEADADDVE------ADLETVEFPVPEPDDEDEEPDDPK
719|gene|hut        DAAETEADLD----------DVEGTLSAIE------EDLVDADL--PEPDEDED---DPQ
11443|hp|hma        EAAETEADLD----------DVESSLDDIE------SDLEAADL--PEPDEDDDDAEDPC
2024|gene|hhi       EAAETEADLD----------DVESSLDDIE------SDLEAADL--PEPDEDDDDAEDPR
                    :  .:*  :*           ::               :    :  .    :     .  

4401|gene|hhi       RILHDQLTGGQLPTLEQLRTRIVTGGYTDPVAFVLENGWGDIDDSPGTIEQMQDLLTSEG
782|hp|nrc1         AALTDHLAEVR-DGVDDQR-----GPYASDAAETVDAAQSTIGETR---------WTDQG
2402|gene|hla       GDLEDRIAELR-DGVEEAR-----GPYAEDVIDAIEAAASTLEDTE---------WTADG
1584|gene|hwa       DELEARIEDLE-SELDIQR-----GPYASDVIEPLEEATTTIEETR---------WTATG
21990|gene|hbo      ADLESRLSDLR-DDLESQR-----GPYAEDVVDDIESAQSKISDTQ---------WTDRG
1020|gene|hvo       EELESRLSDLR-DDLESQR-----GPYADDAVETLEEAKSTITDTR---------WTEQG
3228|gene|nph       EPLVDRLSDIR-DGIEDQR-----GPYGDDVASDANGAAGQIRSTR---------WTRDG
719|gene|hut        EALEDRLSDLR-DGVADQR-----GPYVEDIAEQVETAAGTVSETR---------WTDDG
11443|hp|hma        EELESQLSDLR-DDLDEQR-----GPYAEDVVTIVSNAADTVTDSE---------WTDDG
2024|gene|hhi       EELESQLSDLR-DDLDAQR-----GPYAEDVVTIVSDAEDTVTDSE---------WTDDG
                      *  .:       :   *     * * .      . .   : .:           *  *

4401|gene|hhi       VDAVASEDEPAGIVAATRRWAVAEWLIHAGVDAERFPTECRAET---------------A
782|hp|nrc1         EDDLAA--------------VVAQFREAAG---DALGET--------------------F
2402|gene|hla       RDDAAD--------------AVDAFVEEAS---ESVAVDAFPE----------------H
1584|gene|hwa       LSTITD--------------AVDETYTNIA---ETVSNSITVDTSLEKIDVPADGDGSNS
21990|gene|hbo      EGEIVD--------------VVESFADDVN---DTLDASVSVS----------------G
1020|gene|hvo       DGEIVA--------------AVETFADEFN---GVLDASVSVD----------------G
3228|gene|nph       RPAVKA--------------AVETFLDAAG---EQLDTDFEA-----------------G
719|gene|hut        EEAVIA--------------AVEAFGEAVA---EHVDVNG-------------------A
11443|hp|hma        EGEAQE--------------AVETFLDESA---EFIDHDADT-----------------G
2024|gene|hhi       EGEAQE--------------AVETFLDESA---EFVDHDADT-----------------G
                                        .*             .                        

4401|gene|hhi       GDHD--LPELKSLLNNTTSAGLLADRYLGEATWPDVVAAVDDPWDLADCLVDAALERRLW
782|hp|nrc1         DETGDLGADLAAVSERISAAGLDAD---------ADADTIESLVAATDSLDEGVADAQEW
2402|gene|hla       DDLDELIAALDAVAEAVADADLDPD---------ADAETIAALIDATDGLEAGLDDAEEW
1584|gene|hwa       DEEAQLIAQLDGCMSAIADEGLDAD---------DDAATIETLIETAETLTEDLESAEEW
21990|gene|hbo      DDEAALTAALDDAISAVESAGLDAD---------EDAETIDSLLEATDELEAGLEDAEEW
1020|gene|hvo       DDEDALTAAIDDAVSAIEAADLDAD---------DDAETIADLIEVTDGLADGLDDAQEW
3228|gene|nph       DDIDAFADAVETVAETAADGRLDAD---------DDAETIAALLDAVDDLESDLDDAEEW
719|gene|hut        GDIQAASEALTAASDVLADRDLDPD---------DDSEVIASLLDAAETLADDIEAAEAF
11443|hp|hma        GDFVAAGDALTTVVDAIEAANLDPD---------EDTETIEGLLEAAETLETGLDEAEVW
2024|gene|hhi       GDFVAAGDALTTVVDAIEAANLDPD---------EDTETIEGLLEAAETLETGLDEAEVW
                    .:       :    .      * .*             .:      .: *         :

4401|gene|hhi       EEWHASFDAGDYETCLERAAERYDALLGSEDFRGTYRGAYGPDSPWTQTWEQAAEVARLA
782|hp|nrc1         D---------DLSVRQKLRAEGYYEVM-GDKHKD-----FPPE--WT-------AL----
2402|gene|hla       D---------DLETHEQLRAQGYYDVL--GHYKD-----FPVE--WS-------AL----
1584|gene|hwa       D---------DLEVNEQLMAEGYYDVL--GHYKD-----FPPE--WS-------AL----
21990|gene|hbo      D---------DLETNEKLQAQGFYDVL--GHYKD-----YPPE--LS-------AL----
1020|gene|hvo       D---------DLETREKLQVQGFYDVL--GHYKD-----FPPE--LS-------AL----
3228|gene|nph       S---------DLEVAEQLRREGFYDRLTAENRRD-----FPPE--LN-------VV----
719|gene|hut        D---------DLSVRAKLRYEGFYEVIEGEHRKD-----FPPE--LN-------AVLSWE
11443|hp|hma        D---------DLTVQEQLDARGFYDILTNENRKD-----FPPE--WN-------AA----
2024|gene|hhi       D---------DLTVQEQLDARGFYDILTNENRKD-----FPPE--WN-------AA----
                    .         *  .  :     :   :     ..     :  :   .             

4401|gene|hhi       HQLETWDERATDDVVSLYADPD-DGTWQIDNAMLSLVVAGA----PESDLPADHPAVDTL
782|hp|nrc1         ---KQWEQRGNVEMILLCMEHLDDSEFMQRHCLDALLHVAK----PA--------ALDAV
2402|gene|hla       ---KEHEARGNVDMILLALNSL-ESDFMERHCLEAFERMGKRGKTEA--------SLEEL
1584|gene|hwa       ---KEWEKRGRVDMVLLAKESL-QSEFMQDHCMNALVRMAD----PA--------AFDEM
21990|gene|hbo      ---KEWEKRGRADMILLAKDNL-QSEFMQEYCMEAFVRMGD----PA--------VFDEM
1020|gene|hvo       ---KEHEKRGNVEMIALAFESF-QSDFMQEYCIEAFTRMND----DR--------AYETI
3228|gene|nph       ---RIAEAENDPERILMAFEQL-DSDFMQENCIDALSRLGP----EA--------AFEEM
719|gene|hut        HRYKQSRDPDDVEQILLALDLM-DSEFMEENILDAFERVGP----PE--------AFDPV
11443|hp|hma        ---KLHAEEGDFDQVLFAYDKL-GSEFFDGYIVDLLYNLGS----DAE------PAFDAM
2024|gene|hhi       ---KLHAEEGDFEQVLFAYDKL-GSEFFDGYIVDLLYNLGS----DAE------PAFDAM
                                : : :  :    . :     :  :                     : :

4401|gene|hhi       DDLRTQLQSEYVEYLEALGDRVTETVEAGAPFVDED--HSYQFFTKESAGLESGQTVALF
782|hp|nrc1         GQLAARRDPKAIEVVGKIGVE--DGLEHIEEYVAEDGSPNLRTTALKAVGEIGSRESTQV
2402|gene|hla       LGRAEKRDQFAIRILGKMAAE--EATETLVEFVSEDSNPQLQKIVFKALGEIGAAEAVQP
1584|gene|hwa       HELAQRRDKTAIKALGRMGSGATDAVETLSEYIDEDSDPGLQKVTFRALGEIGSSNVTQP
21990|gene|hbo      HQLAQRRDKTAIKALGKMGADAAEAVETLVEYVDTDSDPALQKVTFKALGEIGSAEATQA
1020|gene|hvo       EGQAKRRDKGVIKAIGKMAAE--EGVEMLVDYVDTDSDPALQKVVFKALGEIGSEEATQP
3228|gene|nph       NQLAQRREVGAIEVLGKIGDE--RAVETLSDFVDS-GNPPLQKATIRALGEIGSQEATQP
719|gene|hut        HQLAQRRDKQAIRVLGKIGDD--RAVETLVDFLDGD--PALQRVTLRALGEIGSHEATQA
11443|hp|hma        HQRAQKREKGPIEVLGKIGDE--RATETLHDYIDGDGDPALQKVTLRALGAIGSAESVQP
2024|gene|hhi       HQRAQKRDKGPIEVLGKIGDE--RATETLHDYIDGDGDPALQKVTLRALGAIGSAESVQP
                         . :   :  :  :.       *    ::        .  .  : *  ..   .  

4401|gene|hhi       VIDALRLDLARRLADELRDYVATLPADAPEFAVDEDVWLGTLPSETEFGKAALTPGEIQM
782|hp|nrc1         VADQLVAE-----RADVRSQAARA--------------LGLI-------------GDTRA
2402|gene|hla       LADQLDPE--GDTEDLVRPHAARA--------------LGLI-------------GDTRA
1584|gene|hwa       LANKLIME-----NDNVRPYAARA--------------LGLI-------------GDTRA
21990|gene|hbo      IADKLVMD-----NENVRPFAARA--------------LGLL-------------GDTRA
1020|gene|hvo       IANKLVTE-----NDNVRSAAARA--------------LGLI-------------GDTRA
3228|gene|nph       LANALADE-----EPMVRSMAARG--------------LGLI-------------GDTRA
719|gene|hut        VANCLDDD-----TDSVRSSAARA--------------LGLI-------------GDTRA
11443|hp|hma        VANRLDAD-----SEEVRSVAARA--------------LGLL-------------GDTRA
2024|gene|hhi       VANRLDAD-----SEEIRSVAART--------------LGLL-------------GDTRA
                    : : *  :        :*  .*                ** :             *: . 

4401|gene|hhi       FDVSLVDGELQPLRNNRKVNTNRRNSLLGGDGWTVTRDTEDGWQSTRVAYFKNDLDDIGE
782|hp|nrc1         IA---------PLVD-----------ILESDD-SETVRASAAWA----------LVQIGT
2402|gene|hla       ID---------PLAD-----------ALAEDD-SDDVRAAAGWA----------LRQIGT
1584|gene|hwa       IQ---------PLGE-----------TLRTDE-SDDVRAAAAWA----------LRQIGT
21990|gene|hbo      ID---------PLAD-----------TLADDE-DNTVRAAAAWA----------LRQIGT
1020|gene|hvo       VE---------PLSD-----------VVADDD-EDAVRASAAWA----------LRQIGT
3228|gene|nph       IA---------PLED-----------VLGDDDEPPEVRASAAWA----------LVQIGT
719|gene|hut        ID---------PLAD-----------VLAEDD-ADDARASAAWA----------LNQIGT
11443|hp|hma        IE---------PLSD-----------VLKSGE-SDSVRASAAWA----------LRQIGT
2024|gene|hhi       IE---------PLGD-----------ILESDD-SDSVRASAAWA----------LRQIGT
                    .          ** :            :  .       :  .*           * :** 

4401|gene|hhi       KELSDLEAMLARRVDSLAEFIGTKLEQGEWDQAYVLTDHGFVLLPDSASPEKISRPAEAS
782|hp|nrc1         EA----------ALEAAAEYAD--------DRAYVVE--------------------QEA
2402|gene|hla       RE----------AIETVAEYAD--------EHSFIVS--------------------TEA
1584|gene|hwa       RD----------ALQTAAEHVD--------ERSYLIQ--------------------HEA
21990|gene|hbo      EE----------ALETAADYTD--------EQSYLVQ--------------------HEA
1020|gene|hvo       ND----------ALEVAAGYAD--------DRSFLVQ--------------------REA
3228|gene|nph       ER----------ALEAAAAYDD--------DRVYTVQ--------------------LEA
719|gene|hut        ER----------AKEIAAEYAD--------DRAYVVQ--------------------VEA
11443|hp|hma        ET----------ALDEAARYTD--------DRAYIVQ--------------------AEA
2024|gene|hhi       ET----------ALEEAARYTD--------DRAYIVQ--------------------AEA
                                  :  * . .        :. : :                       :

4401|gene|hhi       DSGRRWIAGEDVDEDSPGVLLDSSSRLGYLDANVSVLASPLKRFKKQGLGDARFYHGGLL
782|hp|nrc1         TKAVTALDHRDAADASTGSA----------------------------------------
2402|gene|hla       EKAEQSLDAASATA----------------------------------------------
1584|gene|hwa       KRAADALESAPA------------------------------------------------
21990|gene|hbo      ELARERLGDADADAPTA-------------------------------------------
1020|gene|hvo       ELAAEFLGDDVEAEATV-------------------------------------------
3228|gene|nph       EKAREATA----------------------------------------------------
719|gene|hut        EKAAGV------------------------------------------------------
11443|hp|hma        EKAASA------------------------------------------------------
2024|gene|hhi       EKASSA------------------------------------------------------
                      .                                                         

4401|gene|hhi       PQEFVLDFISITQG
782|hp|nrc1         --------------
2402|gene|hla       --------------
1584|gene|hwa       --------------
21990|gene|hbo      --------------
1020|gene|hvo       --------------
3228|gene|nph       --------------
719|gene|hut        --------------
11443|hp|hma        --------------
2024|gene|hhi       --------------