HOG Organism Gene ID Name Annotation
aHOG1525 hhi 2628 pstB2 phosphate ABC transporter ATP-binding protein
aHOG1525 hbo HBOR08100 Hbor_08100 phosphate ABC transporter ATP-binding protein, PhoT family( EC:3.6.3.27 )
aHOG1525 hut HUTA0910 Huta_0910 phosphate ABC transporter, ATPase subunit
aHOG1525 hut HUTA1595 Huta_1595 phosphate ABC transporter, ATPase subunit
aHOG1525 hwa HQ1468 pstB ABC-type phosphate transport system, ATP-binding protein
aHOG1525 nrc1 VNG2482 pstB1 phosphate ABC transporter ATP-binding
aHOG1525 hma Hma_12146 pstB2 phosphate ABC transporter ATP-binding protein
MUSCLE (3.6) multiple sequence alignment


2482|gene|nrc1      MSDTPQSEPRRSDDRSGADDATAAAAGSTDAAAAAVSSKTGGIAGPPGGPGEVDGDEPAV
1468|gene|hwa       MSETTYTTTEDTDDTNSTDSM--------------------------------------V
910|gene|hut        MSETDTTTDASTSDQTTAG----------------------------------------T
1595|gene|hut       MTETTMASEGSTGTE--------------------------------------------I
8100|gene|hbo       MSNMTQTNPETEEANE-------------------------------------------Q
2628|gene|hhi       MSDSINTEPSTDTQTNGEQTVTATS--------------------------------PST
12146|gene|hma      MSDSINTEPSTDTQTNGERTVETTS--------------------------------PSA
                    *::   :                                                     

2482|gene|nrc1      ARTVGESDEQLQDAWTDYEFDGDAKVSVSDLDTYYGEERALESVSLDIPAESVTALIGPS
1468|gene|hwa       GTTTGETDEYVREEWREYSFDVPTKLGVDDLDVYYGDDQALEGVSMEIPEKSVTALIGPS
910|gene|hut        VTTSGESVEETRDAWTDYDVGGEPIMSVENLDVYYGDDHALKDISMDIPEKSVTALIGPS
1595|gene|hut       ETTSGESTERTREAWTDYEFGSEAVLSVEDLNVYYGDERAIKDVSMDIPEKSVTALIGPS
8100|gene|hbo       MTVVGESDEELREEWIQYEFEGEPKFSVRDLNVWYGDDHALHDISMDIPEKSVTALIGPS
2628|gene|hhi       ETTAGESEEQVREEWRQYEFDGDTKLSVENLDVWYGDDHALKDVSMEIPENSVTALIGPS
12146|gene|hma      ETTAGESEEQVRDEWRHYEFDGDTKLSVENLDVWYGDDHALKDVSMEIPENSVTALIGPS
                      . **: *  .: *  *..   . ..* :*:.:**::.*: .:*::** :*********

2482|gene|nrc1      GCGKSTFLRCLNRMNDRIRGARVEGRVALDDRDVYGDGVNLVELRRQVGMVFQEPNPFPK
1468|gene|hwa       GCGKSTFLRCLNRMNDRVSSARIDGSVTLDSQEIYQDGVNLVELRKRVGMVFQSPNPFPK
910|gene|hut        GCGKSTFLRCLNRMNDRIDAARIEGTVAFDGQDIYQPGTNLVELRKRVGMVFQEPNPFPK
1595|gene|hut       GCGKSTFLRSLNRMNDRIKSARVEGTVEFDGSDIYQEGVDLVELRKRIGMVFQSPNPFPK
8100|gene|hbo       GCGKSTFLRCLNRMNDRIKSARVDGSVKFENQEIYQDGTDLVELRKRVGQVFQSPNPFPK
2628|gene|hhi       GCGKSTYLRCLNRMNDRIKAARIDGSVELEGTEIYDPNANLVELRKRIGMVFQSPNPFPK
12146|gene|hma      GCGKSTYLRCLNRMNDRIKAARIDGSVELEGTEIYDPNANLVELRKRIGMVFQSPNPFPK
                    ******:**.*******: .**::* * ::. ::*  ..:*****..:* ***.******

2482|gene|nrc1      SIRDNISYGPRKHGDLETGLLARLLGRDDRDAERDLVERALRRAALWDEVNDRLGDNALG
1468|gene|hwa       SIRENIAYGPEKHGDIDTGVLARLLGRSDEEQREELVERCLRDAALWDEVHDRLDDNALG
910|gene|hut        SIRDNIAYGPRKHGEINRGLVARLLGRDEKEKEDDLVETSLRKAAIWDEVNDRLGDNALG
1595|gene|hut       SIRENVAYGPRKHGDINRGLAARLLGRDEKDAEDELVERTLRQAALWDEVKDRLADNALG
8100|gene|hbo       SIRKNISYGPRKHGDINTGLLARLTGRDDSDREDELVERSLKQAALWDEVSDRLGDNATG
2628|gene|hhi       SIRENISYGPRKHGEINKGLLARLFGRDDTEKEGELVERSLKQAALWDEVSDRLDDNALG
12146|gene|hma      SIRENISYGPRKHGDINKGLLARLFGRDDTEQEGELVERSLKQAALWEEVSDRLDDNALG
                    ***.*::*** ***::: *: *** **.: :   :***  *. **:*:** *** *** *

2482|gene|nrc1      LSGGQQQRLCIARCLAVDPDVILMDEPASALDPVATAKIEDLIEELAEEYTVVVVTHNMQ
1468|gene|hwa       LSGGQQQRLCIARCLSVDPEVILMDEPASALDPIATAKIEDLIAELSKEYTVVIVTHNMQ
910|gene|hut        LSGGQQQRLCIARALATDPEVLLMDEPASALDPIATSKIEDLIEELAEEYTVVVVTHNMQ
1595|gene|hut       LSGGQQQRLCIARCLAVDPEVILMDEPASALDPIATAKIEDLIEELAEDYTVVVVTHNMQ
8100|gene|hbo       LSGGQQQRLCIARALATDPEVILMDEPASALDPVATSKIEDLIVDLAEDYTVVVVTHNMQ
2628|gene|hhi       LSGGQQQRLCIARCLAVDPEVILMDEPASALDPIATSKIEDLVEELSKDYTVVIVTHNMQ
12146|gene|hma      LSGGQQQRLCIARCLAVDPEVILMDEPASALDPIATSKIEDLVEELSKDYTVVIVTHNMQ
                    *************.*:.**:*:***********:**:*****: :*:::****:******

2482|gene|nrc1      QAARISDQTAVFLTGGRLAEYDATDAIFQNPQSQRVEDYVAGKFG
1468|gene|hwa       QAARISEQTAVFLTGGELVEYGDTDQVFENPQSERVEDYITGKFG
910|gene|hut        QAARISDQTAVFLTGGELVEYDDTEKIFENPESQRVEDYITGKFG
1595|gene|hut       QAARISDQTAVFLTGGELVEYDDTEKIFENPESQRVEDYVTGKFG
8100|gene|hbo       QAARISDQTAVFLTGGYLVEYDDTDKIFENPESQRVEDYITGKFG
2628|gene|hhi       QAARISDQTAVFLTGGELVEYDDTDKIFENPESQRVEDYITGKFG
12146|gene|hma      QAARISDQTAVFLTGGELVEYDDTDKIFENPESQRVEDYITGKFG
                    ******:********* *.**. *: :*:**:*:*****::****