HOG Organism Gene ID Name Annotation
aHOG1520 hhi 901 HAH_0901 hypothetical protein
aHOG1520 hbo HBOR05940 Hbor_05940 hypothetical protein
aHOG1520 hla HLAC0699 Hlac_699 hypothetical protein
aHOG1520 hmu HMUK0905 Hmuk_0905 conserved hypothetical protein
aHOG1520 hut HUTA1039 Huta_1039 conserved hypothetical protein
aHOG1520 nph NP2124 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


2124|hp|nph       -MAGEGLDIDIDITDIAAVADAREQLLAAVADHAGEIAADIARLDGGDYGSRSFSTDRGQ
1039|chp|hut      ----MTTGLDSEIGGTEAAAERRDEVVAEVTEHAGRIARELARLQGGDYGQADFETEAGT
5940|hp|hbo       ----MTEAIDFDFADTAAVAERRDEVVAAVESHAGRIARELALLQGGDYGQEAFNTPRGT
699|hp|hla        MTTHADLGLDLDVCDTDAVADRRDELVAAVRDHAGTIAYQLAKLQGGDYGRQELSTPGGT
901|hp|hhi        ----------MDPADATAVAQQRDELVAAVRDHAGQVAYQLARLEGGDYGQADIETDRGE
                             :  .  *.*: *::::* * .*** :* ::* *:*****   :.*  * 

2124|hp|nph       WTLKHERGTLQYLRYEPQGGGETYVVSTQRPAAPEPLSDALADYDAFVTAYNDYVDRVAG
1039|chp|hut      WTLKYEAGDVQYLRFDG-RGADVYVVSTQQPPDPDALATAMADYDAFVAAFNEHVRSLAG
5940|hp|hbo       WTVKYEGGALQYLRYEGNGGSETYVVSTKRQPDPTELATAMQDYESFVESYNDYVESRSG
699|hp|hla        WTVKHEAGELEFLLFSPKSGSDVYVISTQQPPDPADLATALDDYANFVAAWNEWVGSLSG
901|hp|hhi        WTVKYEGGDLEYLRFSPSRGSDTYVISTKQPPEPEPLAAALADYDAFVEGFNDYVASLDG
                  **:*:* * :::* :.   *.:.**:**:. . *  *: *: **  ** .:*: *    *

2124|hp|nph       LLDDVDDEFPAVRSTADVAAERDRIVDGIERACHRMAEGLYRYEGTEYGTFSARV-----
1039|chp|hut      VLDDVNSDFPAIEPVDSVVAERERILGQMREATDAMARQLQRYEGGDYGTFSARVTDNGG
5940|hp|hbo       VLDDVSTDFPEPHETSGVVAERDRIVDRIREVCDEIAVQLHRYDGTDYGTFATTV-----
699|hp|hla        VLDGVSAEFPEPDSTDGIVAERDRVLDRVRETCSVMAGEIYRYEGDNYGTFTARV-----
901|hp|hhi        VLDDVSTEFPEIATTDGVVAERDRVLGRIREICDQIARELQRYEGGDYGTFTDRI-----
                  :**.*. :**    . .:.***:*::. :      :*  : **:* :****:  :     

2124|hp|nph       -----------DSTRWELKRETERVSYLRVGGSNGIYLLSQYGQPSAADVRSHAPEFGGF
1039|chp|hut      SGGSRRGSSGSGGSRWELKWEDGRTSYLRVGGEGGIYLLSQYQPPSAHDLRAHAPNFPGF
5940|hp|hbo       -----------SGTRWELKRELDRTSYLRVGGEGGVYLLSQYEPPAAPDVRQLVGGFEGF
699|hp|hla        -----------DGDRWELKWDEGTVSYLRVGGSGGLYILSQYEAPSAADVREYADSFRGF
901|hp|hhi        -----------GGTRWELKWDTDGASYLRVGGSNGLYLLSQYEPPSAADIREYAPQFADF
                             .. *****.:   .*******..*:*:****  *:* *:*  .  * .*

2124|hp|nph       VAAYNDHVAELAADLETIEL
1039|chp|hut      VAAFNEEIAAESESLEDVSL
5940|hp|hbo       VESYNDYVAELESDLDGISL
699|hp|hla        VEAYNEFVAELESDLAAVEL
901|hp|hhi        VDAYNDHVDELESDLGTVEL
                  * ::*: :     .*  :.*