HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0152COG1164arCOG04758Oligoendopeptidase Foligopeptidase

HOG Organism Gene ID Name Annotation
cHOG0152 nrc1 VNG2001 yjbG oligopeptidase
cHOG0152 hmu HMUK1306 Hmuk_1306 oligoendopeptidase F( EC:3.4.24.- )
cHOG0152 hma RRNAC3189 pepF oligoendopeptidase F
cHOG0152 hwa HQ1110A pepF oligoendopeptidase
cHOG0152 hla HLAC2686 Hlac_2686 oligoendopeptidase F
cHOG0152 hbo HBOR04480 Hbor_04480 oligopeptidase F( EC:3.4.24.- )
cHOG0152 hut HUTA1161 Huta_1161 oligoendopeptidase F
cHOG0152 hvo HVO_1847 HVO_1847 pepF oligoendopeptidase F
cHOG0152 nph NP5040A pepF oligoendopeptidase
cHOG0152 hhi 452 pepF oligoendopeptidase F
MUSCLE (3.6) multiple sequence alignment


2001|gene|nrc1      MPPATSGTGLISGAVAGNHPVVCERLTGRTRTLGHMSSVPDRADVADEYKWALASIYETD
5040|gene|nph       -----------------------------------MSSVPERSDIDETYTWDLTDLFADD
1161|gene|hut       -----------------------------------MSTVPERSEIDEEYKWDLASLYADT
13189|gene|hma      -----------------------------------MSSVPARSDIDEAYKWDLDSLYATD
452|gene|hhi        -----------------------------------MSSVPARSDIDEAYKWDLDSLYASD
2686|gene|hla       -----------------------------------MSSVPERAEIDEAYKWDLQGIYADD
1110|gene|hwa       -----------------------------------MSSIPERNEIETEYTWDLSGIYTDA
4480|gene|hbo       -----------------------------------MSSVPERSEIDSEYKWDLESIYASD
1847|gene|hvo       -----------------------------------MSSVPERSDIDEEYKWDLDSIYASD
                                                       **::* * ::   *.* * .::   

2001|gene|nrc1      DEWEAAFEDVQAELDALNDYEGRLTEDGETLLAALELRDAVYRDAKTVSAYASMRSDEDT
5040|gene|nph       EAWEDAFGELEGRLEDLAAYEGRVTESPETLQSVLELRESVMRQAANVAAYARMRKDEDT
1161|gene|hut       DEWETAFEEANELTEVVASYEGQATEDAETLLSVLEDYEALMRTVSNVVSYARMRQDEDT
13189|gene|hma      EDWEAAYEEAEELIEDLSAYEGRATEDAATLLETLETYEDLMRTVSNVAAYARMRRDEDT
452|gene|hhi        EDWEAAYEEAEELIEDLSAYEGRATEDAATLLETLETYEELMRTVSNVAAYARMRRDEDT
2686|gene|hla       EEWESAYEAVSERIEELEAYEGRVADDAATLLELLELREAIFRDLEQVMTYAQLRSAEDT
1110|gene|hwa       AEWESAYESVQDQLTDLKEYEGHVTESPSTLLELLEQREEIFRTLATVSTYANLRSAEDT
4480|gene|hbo       DEWETAFEDVQERLSEIAAYEGRVTESPETLLELLELQEEIMREVSKVANYASLRSAEDT
1847|gene|hvo       EEWEAAYEDVAERVPELASYEGRATEDPETLLELFETMESVLREVSMVVSYANLRSSQDT
                      ** *:         :  ***. ::.  **   :*  : : *    *  ** :*  :**

2001|gene|nrc1      RDQEYQALQARGASLMTDVSSATSFFDPELQACTREQLQSMIEETPELAAYEHYFDDVLR
5040|gene|nph       TDQTYQALTARARSLAADASSAASFIEPELQALDRETIDEYIDENPALETYDHYFDDVLR
1161|gene|hut       RDDDAKALFARARSLSADASSAASFLDPEIQDLDRDEVEAMIEAEPALEEYEHYFDDVLR
13189|gene|hma      TDDTYQALTARSQSLSSEASSAASFLDPELQDLDYDDIEAMVDEEPALEPYEHYFDDVLR
452|gene|hhi        TDDTYQALTARSQSLSSEASSAASFLDPELQDLDYDDIEAMLDAEPGLEPYEHYFDDVLR
2686|gene|hla       RNQEYQAMSAKASSLGSEASSTISYLEPELQSLTEADVAAFVDDEPALAEYEHYLDDVLR
1110|gene|hwa       RDQESQARQSKAESLSSRARSAISFIEPELQELDSEEISSFCEREPALKQYEHFFDDVLR
4480|gene|hbo       RDQEYQALQAKAESLSSEAQSTVSFVEPELQELSEADVESFIETEPELVDYEHYFDDVLR
1847|gene|hvo       RNQEYQAQAGRAEALASKARSAVSYLDPELQELGRDGVAEFVEKEPELDAYEHYFDDVLR
                     ::  :*  ... :* : . *: *:.:**:*      :    :  * *  *:*::*****

2001|gene|nrc1      MKPHTRSAEVEGLLSELGEVFGAPSDAYNMLTDADLEFPTVEDPA--GDAVEISQSNFTN
5040|gene|nph       MKPHTRSAEIEELLADLGDVTDAAGDVYNMLTNADMEFPAVEDPD--GEPQPITLSNFTT
1161|gene|hut       MKPHTRSTEVESLLADLSEVTGAAGDVYDMLTNADMSFPTVEDSQ--GEAVEITLNNFTT
13189|gene|hma      MKDHTRSAEVENLLAELGEVTGAPGEVYNMLANADMTFPTVEDPD--GDQQPITLNNFTT
452|gene|hhi        MKDHTRSAEVENLLAELGEVTGAPGEVYNMLANADMEFPTVEDPD--GDQQPITLNNFTT
2686|gene|hla       MKAHTRSAEVEEVLADLSEVTDAPSEIYSMLTNADMTYGVVENPD--GEEVEITQANFTK
1110|gene|hwa       AKPHTRSSEVESVLADLGEIASSPSDIYGMLSNADMTFPTVDHPDPGEDTIEITLGNFTK
4480|gene|hbo       MKPHTRSAEVEEVLAELGEVASAPSDIFGMLSNADMTFPTVENPE--GEEVEISQGNFTK
1847|gene|hvo       TKEHTRSAEVEEVLADLSEVTGASSDIYSMLANADLEFPTVEKPD--GTSVEITQGNFTK
                     * ****:*:* :*::*.:: .:..: :.**::**: : .*: .        *:  ***.

2001|gene|nrc1      LLKTPDRAFRQTVHEQFYDTISGVRNTIGSTMKTQMKRDVKLAEARNYDTARQAALDSGN
5040|gene|nph       LQKHPNREFRRRVYESFYDEWADYRNSVATAYKKSVKADEKLAAARNYDSAREAALNGPN
1161|gene|hut       LQKRQDRQFRREVYEGFYDEWEDVRNAVGSAYKNAVKTDSKIAQARNYETAREAALDGPN
13189|gene|hma      LQKHPDRDFRQRVYEAFYDEWETVRNAVGTAYKNAVKTDVKMANARDYDTAREAALDGPN
452|gene|hhi        LQKHPDREFRQRVYRAFYDEWETVRNAVGTAYKNAVKTDVKMANARDYDTAREAALDGPN
2686|gene|hla       LQKNPDRKFRERVHETFYDEWAGVRNTVGTSLKKAVREHATSAEIRGYDSARQAALDGSN
1110|gene|hwa       LQKHPDRAFRQTVYEQFYDEWKDVRNTVGTALQNSVKKDVKYARARRYESARAASLDGPN
4480|gene|hbo       LQKHPNRQFRREVYQQFYDEWGDVRNTVGTALKNSVKKDVKYANARNYETAREAALDGTN
1847|gene|hvo       LQKHPDREFRRTVHEEFYDRWADVRNAVGTSLKNSVKKDVKTARIRDYETAREAALDGPN
                    * *  :* **  *:  ***     **::.:: :. :.   . *  * *::** *:*:. *

2001|gene|nrc1      IPVEVYDTLVDTVDDNLDTLQRHADLKRRALGVDDLEMWDLYMPIVDSEGPDIEYADARE
5040|gene|nph       VPVAVYETLVETVEDNLDVLHRHAALKRDCLGVDELRMWDLYAPLENDESPTVDYEQAKS
1161|gene|hut       VPTDVYDTLVETVRGNLDPLHRHAELKREHTDGEELAMWDLYVPLTETESPEIEYEQACE
13189|gene|hma      VPVEVYDTLVDTVHDNLDTLHRHADLKRQSIGADELRMWDLYTPLVQEESPEIEYEQACE
452|gene|hhi        VPVEVYDTLVDTVHDNLDTLHRHADLKRQSIGADELRMWDLYVPLVQEESPEIEYEQACE
2686|gene|hla       VPVEVYDTLVDTVDDNLDVLHRHAELKADALGVDQLESHDLYMSLTGDQGPDVAYEQARE
1110|gene|hwa       VPVTVYDTLCETVRDNLEHLHRHARLKQAALNLNELRPWDLYISLTGDESPKIPYDRATT
4480|gene|hbo       VPVEVYDNLVETVRDNLDYLHRHAELKRGALGVEELEMWDLYMSLTGDEGPEITYEEAKE
1847|gene|hvo       VPVEVYDNLLDTVRDNLGHLHRHAELKREAIGADELRMWDLYVSLTGDHGPEIPYEQAKE
                    :*. **:.* :** .**  *:*** **    . ::*  .*** .:    .* : *  *  

2001|gene|nrc1      HVIEAVAPLGEDYQQRVADGLDSNWVDVYENRGKRSGAYSGGTYDTQPFILMNYQDDISS
5040|gene|nph       YVIDAVAPLGDDYRDRMAEGLESQWVDVYETENKQSGAYSGGTYDSQPYILLNYQDDISS
1161|gene|hut       YVVDALAPLGEAYQSRVAEGLDSRWVDVYETRGKQSGAYSGGTYDSQPFILMNYQDDVES
13189|gene|hma      YVTEAVAPLGDDYQSRLADGLDSRWVDVYETEHKQSGAYSGGTYDSQPFILMNYQDDVES
452|gene|hhi        YVTEAVAPLGDDYQSRLADGLDSRWVDVYETEHKQSGAYSGGTYDSQPFILMNYQDDVES
2686|gene|hla       WVIEAVAPLGEAYQERMAEGLDSRWVDVYENRGKRSGAFSSGTYDTQPYILMNYQDDIAS
1110|gene|hwa       YITDAVAPLGSEYQQRVADGLESRWVDVYENRGKRSGAFSSGAYDTQPFILMNYQDDISS
4480|gene|hbo       YIIEAVAPLGEEYQSQLAQGLEDRWVDVYENRGKRSGAFSSGTYDTQPFIMMNYQEDISS
1847|gene|hvo       YIVEAVEPLGEAYQERMAEGLDDRWVDVYENRGKRSGAYSAGTYDTQPFIMMNYQDDSAS
                     : :*: ***. *...:*:**:..******.  *.***:*.*:**:**:*::***:*  *

2001|gene|nrc1      MFTLAHELGHSLHSQYTSEHQPYVYSNYEIFVAEVASTVNEALLVNHLLDTVEDDHFRRH
5040|gene|nph       MYTLAHELGHSMHSELTSETQPYTYSNYEIFVAEIASTVNETLLTKHLLETVDDAAFRRH
1161|gene|hut       MYTLAHELGHSLHSEYTSEAQPYVYSGYEIFVAEVASTVNEALLTRHLLDTVEDDRLRRH
13189|gene|hma      MYTLAHELGHSMHSEYTSEEQPYVYSGYEIFVAEVASTVNETLLTHHLLDTVEDERLRRH
452|gene|hhi        MYTLAHELGHSMHSEYTSEEQPYVYSGYEIFVAEVASTVNETLLTHHLLDTVEDERLRRH
2686|gene|hla       MFTLAHELGHSMHSELSGDTQPWHDASYDIFVAEIASTVNETLLTHHLLDTVEDDELRTH
1110|gene|hwa       MFTLAHELGHSMHSELAKNAQPWQYADYTIFVAEVASTVNETLLTNHLLETLEDDTLRLH
4480|gene|hbo       MFTLAHELGHSLHSELAKEEQPWHYADYTIFVAEVASTVNETLLTQYLLENVEDDEFRMH
1847|gene|hvo       MFTLAHELGHSMHSELANDAQPWHDASYEIFTAEVASTVNETLLTEYLLENVDDDELRMH
                    *:*********:**: : : **:  :.* **.**:******:**. :**:.::*  :* *

2001|gene|nrc1      ILNEYLERFRSTLYRQTLFADVEQRLHELTRAGEALTPDRIDEVYGDRKRAYYANATIDD
5040|gene|nph       VLDEYLERFRSTLFRQTMFADFEHRAHELNAAGEALTPDRLDELYRELKAEYYEPAVVDD
1161|gene|hut       VLDTYLERFRSTLYRQTMFAEFEHRAHEMSEAGEPLTPDRLDDLYGELKGDYYAPGEIDD
13189|gene|hma      ILNEYLERFRSTLYRQTMFAEFEHRTHEMSEAGEPLTPDRLDDLYRDLKGDYYEPAVLDD
452|gene|hhi        ILNEYLERFRSTLYRQTMFAEFEHRTHEMSEAGEPLTPDRLDDLYRDLKGDYYEPAVLDD
2686|gene|hla       VLDEYLERFRSTLFRQTMFAAFEQRIHERVEADDALTPDAFDEIYADLKGDYYAPAELTG
1110|gene|hwa       ILDEYLERVRSTLYRQTMFAEFESTIHEIIEEGGALTPDRFDEIYCDLKETYYEPAVLDD
4480|gene|hbo       VLDEYLERFRSTLYRQTMFADFEHQMHTISEEGGALTPDRLDQLYGDLKREFYAPANVDD
1847|gene|hvo       VLDEYLERFRSTLFRQTMFADFELQIHEIIENDGALTPDRFDELYGDLKETYYEPAATDD
                    :*: ****.****:***:** .*   *     . .**** :*::* : *  :*  .   .

2001|gene|nrc1      HIEREWMRIPHFYYNFYVFQYATGISAAVALVEDILDDDQPDAAARYREFLTRGSSAYPI
5040|gene|nph       HIAREWMRIPHFYRAYYVYQYATGISAATAIVDRIERDGAS-AAADYREFLRSGSRGYPL
1161|gene|hut       RIVREWMRIPHFYRAFYVYQYATGISAAVAIAQSIAEEGDP-AAERYRTFLESGSSEYPL
13189|gene|hma      RIAREWMRIPHFYRAFYVYQYATGISAAVALVDGILDDGEP-AAQRYIDFLRSGSRQYPL
452|gene|hhi        RIAREWMRIPHFYRAFYVYQYATGISAAVALVDGILDEGEP-AAQRYVDFLRSGSRQYPL
2686|gene|hla       GVEREWERIPHFYYNFYVYQYATGISAAAAIVERVLDEGDE-AAADYREMLRAGGSDYPL
1110|gene|hwa       RIAREWMRIPHFYYSFYVYQYATGISAAIAIVDQIDTDGED-AAEDYRSALELGGSAYPI
4480|gene|hbo       RIAREWMRIPHFYYNYYVYQYSTGISAAVAIVERILNEGED-AAADYRDALALGGAKYPI
1847|gene|hvo       RIAREWERIPHFYYDYYVYQYATGISAAAAIVERIREEGES-AAADYREALALGGSEYPL
                     : *** ******  :**:**:****** *:.: :  :.   **  *   *  *.  **:

2001|gene|nrc1      ELLQDAGVDMSTSAPIERAIGVYDHYLDEADDLV---
5040|gene|nph       ELLETAGIDMSTADPVESAIDTYDEMVAEYESLEE--
1161|gene|hut       ELLQTAGVDMTTADPIEDAIAEYDDALDRMADLL---
13189|gene|hma      ELLRDAGVDMASPDPVESALSTYSDYLDEFAELL---
452|gene|hhi        ELLRDAGVDMASPDPVESALSTYSEYLDEFAELL---
2686|gene|hla       DVVELAGIDMASPEPIESAVGIYDEYLDEIAALLDVE
1110|gene|hwa       DILQTAGVDMTDAAPIESALTGYADYLDQMEALVK--
4480|gene|hbo       EVLETAGVDMASPEPIESALSVYGDYLDEMAGLLDTE
1847|gene|hvo       DVLRTAGVDMTEPEPIEDAMSVYAEFLDEAAMLLDLE
                    :::  **:**: . *:* *:  *   :     *