HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0150COG0576KOG3003arCOG04772Molecular chaperone GrpE (heat shock protein)heat shock protein

HOG Organism Gene ID Name Annotation
cHOG0150 nrc1 VNG0494 grpE heat shock protein
cHOG0150 hmu HMUK2845 Hmuk_2845 GrpE protein
cHOG0150 hma RRNAC3340 grpE heat shock protein GrpE protein
cHOG0150 hwa HQ2639A grpE dnaJ/dnaK ATPase stimulator grpE
cHOG0150 hla HLAC1291 Hlac_1291 GrpE protein
cHOG0150 hbo HBOR16230 Hbor_16230 molecular chaperone GrpE (heat shock protein)
cHOG0150 hut HUTA0309 Huta_0309 GrpE protein
cHOG0150 hvo HVO_1592 HVO_1592 grpE co-chaperone GrpE
cHOG0150 nph NP0216A grpE dnaJ/dnaK ATPase stimulator grpE
cHOG0150 hhi 580 grpE heat shock protein GrpE protein
MUSCLE (3.6) multiple sequence alignment


216|gene|nph        ------------------MSDDQGDAVEASS----EADEEASTSPDEGDDRDPVAA----
13340|gene|hma      MTE-------------QDAADDTAATEESTAS---EAQADG--DADLEDVPEDVNADEVD
580|gene|hhi        MTE-------------QDAADDTAATEESTAS---EAQADGNVDADFEDAPEDVTADEVD
309|gene|hut        MTE-------------TEQDDDSAGRAQP--------------DEEGEPTDEQIAALREE
2639|gene|hwa       MSD---------------ESTESHQTAEPSPDSDISGDEDEDENEREHNMNEEEKHQTKD
494|gene|nrc1       MSD---------------HAEHAADAADTDAP---EGDDAG--GDDGEQAGDDGTSALSE
1291|gene|hla       MSD-------------DDAVDVEVESPDAAAD---AARTNGTADAAAEEASSDARADGEA
16230|gene|hbo      MTDESPDGRVSESADADETTDPDVDGSDTTADATAAAEQNGEAEAAETETAAEKEAEAET
                                               :.                               

216|gene|nph        -----------------------VAERAENDPASVAAELV----ALREEAAELE------
13340|gene|hma      -------------LGEFDTDEDLVDRVAESDPEDIARELS----ALRTRVDSLESQVEQ-
580|gene|hhi        -------------LGEFDVDDDLVDRVAESDPEDVARELS----ALRTRVDSLESQVEQ-
309|gene|hut        -------------Q---------LETVREADAEALADELA----AHRLKIERLESELADL
2639|gene|hwa       -------------THGSSENPDENNQDATTEASSLADQVAKYDEALAVEVKSLTNEYDE-
494|gene|nrc1       -------------R---------VRALDADNADALADDVA----ALEARVETLTDELAD-
1291|gene|hla       ----------------------LAAAVAEHD-EALAREVA----ALEADFAETRDELLA-
16230|gene|hbo      AETETAEAEAVGDAANAETTGDVAARVAEYD-DELADEVA----ALERRVQKLETKLAT-
                                                  :   :* ::     *               

216|gene|nph        --------TERDDLESRLKRKQAEFQNYKKRQEKQREKERARATEALVEKLLEVRDNLNR
13340|gene|hma      ------QDGDIEELEEKLKRKQAEFQNYKKRMDKRREQEQKRATEDLVTRLLDVRDNLER
580|gene|hhi        ------QDDDIEELEEKLKRKQAEFQNYKKRMDKRREQEQKRATEDLVTRLLDVRDNLER
309|gene|hut        EETVEGKDEEIEDLTSRLKRKQADFQNYKKRMKQKREDEKQRATEDLVERLLDVRDNLRR
2639|gene|hwa       ------QRERIDELEAALKRSKADFENYKKRAKKREQQIRERATEDFVGRIVGVRDNLVR
494|gene|nrc1       ------AEDEVADLTERVQTKQADFKNYKERAKRKQEEIRERATEDLVERLLDVRDNLDR
1291|gene|hla       ------AEEEVEELTSKLARVKADFSNYKQRAKRKQDEIRERASEALVERITPVRNDLLR
16230|gene|hbo      ------KAEEADELTERLKRTQADFQNYKKRAKKRQDQIRETATEDFVERVVTVRDNLLR
                                :*   :   :*:*.***:* ... :. .  *:* :* .:  **::* *

216|gene|nph        ALEQDA----DADIREGVEATFRQLDDILDGEGVEAIEPDPGTETDPKRHEVLLQVESDE
13340|gene|hma      ALGQDE----DTDIRGGVESTLRQLDDVLDAENVEVIDPDPGGDVDPTQHQVLARVDSDQ
580|gene|hhi        ALGQDE----DTDIRGGVESTLRQLDDVLDAENVEVIDPEPGGDVDPTQHQVLARVDSDQ
309|gene|hut        ALDQDD----VADLRDGVKSTLSQFETELDRENVTSIEPEPGDEVDPERHEVLVRMDSPQ
2639|gene|hwa       ALEQDS----DADIRPGVESTLDEFDRVLEDENVTLINPERGDNVDPAQHEVLMRVDADL
494|gene|nrc1       ALDQEESESDEDGIREGVELTRDEFDRVLETEGVTEIRPEPGDSVDAARHEVMMRVDSDQ
1291|gene|hla       ALDQEE----GSDLRPGVESTLEKFDEVLADEGVEAIDPEPGEEVDPARHQVMLRVESDQ
16230|gene|hbo      ALDQDE----DADIRPGIESTLEEFDRILADEDVSTIDPEPGEEVDPTRHEVMMRVESDQ
                    ** *:       .:* *:: *  :::  *  *.*  * *: * ..*. .*:*: .:::  

216|gene|nph        PEGTVAELHRPGYEMAGKVLRAAQVTVSEGPSGDSEAEDDADGEDGDE------------
13340|gene|hma      PDGAIADVHRPGYEMADKVLREAQVTVSESEE----------------------------
580|gene|hhi        PDGAIADVHRPGYEMADKVLREAQVTVSESEE----------------------------
309|gene|hut        PDGTIAEVHRPGYEMAGKVIRTAQVAVSDGQSGDETVSETTESDESESSGK---------
2639|gene|hwa       PEGTVAEVFQQGYQMAGTVIQEAQITVSTGADITENKNENENENPDANANTDTDAMKEET
494|gene|nrc1       PAGTIVDVYRPGYEMSGRVVRAAQVTVSEE------------------------------
1291|gene|hla       PSGTVHEVYEPGYEMGDRVVSEAKVTVSADEE----------------------------
16230|gene|hbo      PEGTVADVYQPGYEMAEKVIREAQITVSKDDE----------------------------
                    * *:: ::.  **:*.  *:  *:::**                                

216|gene|nph        --------
13340|gene|hma      --------
580|gene|hhi        --------
309|gene|hut        --------
2639|gene|hwa       NSLENESE
494|gene|nrc1       --------
1291|gene|hla       --------
16230|gene|hbo      --------