HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0015COG0277 COG0247KOG4730 KOG1231 KOG1232arCOG00337glycolate oxidase subunit

HOG Organism Gene ID Name Annotation
cHOG0015 nrc1 VNG2422 glcD glycolate oxidase subunit
cHOG0015 hmu HMUK2547 Hmuk_2547 D-lactate dehydrogenase (cytochrome)
cHOG0015 hma RRNAC1967 glcD1 glycolate oxidase subunit GlcD
cHOG0015 hma RRNAC2334 glcD2 putative oxidoreductase
cHOG0015 hma PNG7284b glcD3 putative oxidoreductase
cHOG0015 hwa HQ2550A glcD oxidoreductase ( glycolate oxidase iron-sulfur subunit)
cHOG0015 hla HLAC0210 Hlac_210 FAD linked oxidase domain protein
cHOG0015 hla HLAC1400 Hlac_1400 FAD linked oxidase domain protein
cHOG0015 hbo HBOR30510b Hbor_30510 FAD/FMN-dependent dehydrogenase
cHOG0015 hbo HBOR15140 Hbor_15140 FAD/FMN-dependent dehydrogenase
cHOG0015 hut HUTA2438 Huta_2438 D-lactate dehydrogenase (cytochrome)
cHOG0015 hvo HVO_1697 HVO_1697 glcD glycolate oxidase subunit
cHOG0015 nph NP1452A dld_2 D-lactate dehydrogenase / iron-sulfur protein ( glycolate oxidase iron-sulfur subunit)
cHOG0015 hhi 2779 glcD2 putative oxidoreductase
cHOG0015 hhi 2478 glcD1 glycolate oxidase subunit GlcD
cHOG0015 hhi 5274 glcD3 putative oxidoreductase
MUSCLE (3.6) multiple sequence alignment


210|gene|hla        MASEPTRGDNTPG---LDTSAAALGHE-RPDVPAYRALAEDLRERVDGEVQFDEYAQVLY
30510|gene|hbo      MMNFVMAIEDR-----DAWSARELGHD-RPDAVKYRDLARDLRARVEGGVEFDEYAQILY
11967|gene|hma      MAIENVE---------DIWSAQELDLN-RPDVDAYRDLAEALRARVTGGVEFDEYARILY
2478|gene|hhi       MAIENVE---------DTWSAQELDLD-RPDVDAYRDLAEALRSRVSGGVEFDEYARILY
1452|gene|nph       MATEGGDRTTGT----DPAVDERASYDYTGGDTDRPGLVADLKRLIDGEVRFDEYTRTLY
2422|gene|nrc1      MATRDLRSD-------DPSTDPDADYDYTSDSVERPGLVDDLRERVDGDVRFDSYTRQLY
2438|gene|hut       MGISDQVGPGVPDSI-DPAADSRATYDYVSDDVQRPGLVSDLEERIEGDVRFDEYSRQLY
7284|gene|hma       MAYDSRLPEQR-----DPATDPSANYDYQGDSVNRPDLVSALEQRVDGDVRFDTYTRELF
5274|gene|hhi       MAYDSRPPEER-----DPATDPSANYDYQGESVHRPDLVAVLERRVDGDVRFDTYTRELF
12334|gene|hma      MATDSGTRI-------DPSADEVSNYDYQNETVARSGLVDDLQARVNGEVRFDEYSRQLY
2779|gene|hhi       MATDSGTRI-------DPSADEVSNYDYQNDTVARSGLVDDLRARIDGEVRFDEYSRQLY
1400|gene|hla       MATNTP----------DPDPRDGGDFDYTGGAVERPGLVDALEDRVDGNVRFDEYSKRLY
2550|gene|hwa       MATNTPSTVDERSLGSESDPAGEGTYDYVSDDIERPGLMEDLDARVDGDVRFDTYSRQLY
15140|gene|hbo      MASNARER--------TTDPAADGNYDYVSDDVARPGLVSDLESLVDGEIRFDTYSRQLY
                    *                         :          *   *   : * : ** *:. *:

210|gene|hla        ATDGSIYQARPAGVVTPRSVADVQATMRVAADHGVPVIPRGAGSSLGGQTVGPGCVVLDF
30510|gene|hbo      STDGSIYRAKPAGVVFPTDTSDVQAAVEVATSHEVPILPRGTGSSLAGQTVGPGCVVLDV
11967|gene|hma      ATDGSIYRAEPAGVVYPTDIDDVRAAVEVATSHGVPILPRGTGSSLAGQTVGPGCVVLDM
2478|gene|hhi       ATDGSIYRAEPAGVVYPTDTDDVRAAVEVATSHGVPIMPRGTGSSLAGQTVGPGCVVLDL
1452|gene|nph       ATDASAYEVTPIGVVFPTDTDDVSAVVSYCAERSIPVLPRGGGTSLAGQTVNK-AVVVDF
2422|gene|nrc1      ATDASIYEALPVGVVFPTSTDDVAAVVSYCADRGIPVLPRGGGTSLAGQAVNE-AVVLDF
2438|gene|hut       ATDASAYEVLPVGVVFPQSTADVASVVEYCAAREIPVLPRGGGTSLAGQTVNE-AVVLDF
7284|gene|hma       ATDASAYEQLPIGVVSPVSTEDVVAVMEYCAAEDIPVLPRGGGTSLAGQAVNE-AVVLDF
5274|gene|hhi       ATDASAYEQRPIGVVSPVSTDDVVTVMEYCAEQGIPVLPRGGGTSLAGQAVNE-AVVLDF
12334|gene|hma      ATDASLYEVLPIGVVYPQSTEDVAAVMSYCAQREIPVLPRGGGTSLAGQTVNE-AVVLDF
2779|gene|hhi       ATDASLYEVLPIGVVYPRSTDDVAAVMSYCAQREIPVLPRGGGTSLAGQTVNE-AVVLDF
1400|gene|hla       ATDASAYEVTPIGVVVPESTADVAAVHEYCYEEGIPVLPRGGGTSLAGQTVNE-AVVLDL
2550|gene|hwa       ATDASAYEQTPIGVVMPAHTSDVSAVMDYCATQEIPVLPRGGGTSLAGQTVNE-AVVIDL
15140|gene|hbo      ATDASAYEQTPIGVVMPESTEDIVAVMEYCSKREIPVLPRGGGTSLAGQTVNE-AVVLDL
                    :**.* *   * *** *    *: :.   .    :*::*** *:**.**:*.  .**:*.

210|gene|hla        STHMDEIQEVRPDDRRAVVQPGVVQDQLDDRLTEDGLKFAPDPASSARATVVGGIGNNST
30510|gene|hbo      SRHMDDILEIRPDEKRVRIQPGVVQDDLDAALSEYGLKFAPDPASSNRATVGGGIGNNST
11967|gene|hma      SRHMDDILDIRPDEQTAHIQPGVVQDDLDDTLANYGLKFAPDPASSNRASVGGGIGNNST
2478|gene|hhi       SRHMDGILDIRPGEQTAHIQPGVVQDDLDDTLAEYGLKFAPDPASSNRASVGGGIGNNST
1452|gene|nph       TRHMNSLLTVDEEARTATAQPGVRLGDLDKRLD--GLTFPPDPAWGDKSALGGAIGNNST
2422|gene|nrc1      KHAMNGFVGFDPEAETARAQPGITLAALNDELAAHGLKYAPDPAWGDKSVLGGAIGNNST
2438|gene|hut       TRYMDSVLETDPDAARARVQAGTYIGDMNAAFAEHDLKFAPDPAYGDKSAVAGAIGNNST
7284|gene|hma       KRYMDETLSVDPEARRARAQAGITIARLNDRLEPHGLKFAPDPAWGDKSVLGGAIGNNTT
5274|gene|hhi       KRHMDETLSVDPEAGRARAQAGITIARLNDRLEPHGLKFAPDPAWGDKSVLGGAIGNNTT
12334|gene|hma      SRYMNDLVGARPDDRRARAQPGIKLGDLNGELADHGLKFAPDPAWGDKSVLGGAIGNNST
2779|gene|hhi       SRYMNELVETRPDDRRARAQPGIKLGDLNGELADHGLKFAPDPAWGDKSVLGGAIGNNST
1400|gene|hla       TGSMDEVLSTDPEAGTARAQAGAYVGDLNAAVEPHGLKFAPDPAWRDKSAIGGAIGNNST
2550|gene|hwa       SRYMDDVKTIDSDNETATAQAGVRLGDLNAAAEPYGLKFAPDPAWGDKSVLGGAIGNNST
15140|gene|hbo      MKHMDGVIDVDTDAATATAQAGVRLGDLNAELEPHGLKFAPDPAWGDKSALGGAIGNNST
                       *:           .  *.*     ::      .*.:.****   .: : *.****:*

210|gene|hla        GAHSVRYGITDAYTEELQVVLADGSLIHTREVVLDSPEYEEIVS---KN--DREAALYET
30510|gene|hbo      GAHSVRYGITDAYTETVTAVLSDGSLLQAREVVIDSSEWNDIVS---KD--DREADIYRT
11967|gene|hma      GAHSVRYGITDAYTDAVKAVLSDGSLIHAREVVIDSPEWDDIVS---KD--DREADIYQT
2478|gene|hhi       GAHSVRYGITDAYTDAVKAVLSDGSLIHAREVVIDSPEWDDIVS---KD--DREADIYQT
1452|gene|nph       GSHSLVYGKTDAYIESLEVVLADGSVHRFGPVTPA--EWQRRAE---ES--SFVGRIYRT
2422|gene|nrc1      GAHSLQYEKADGYLESAEVVLADGTVTTLGWVDTD--DLDALAD---PDG-DLEARIYAD
2438|gene|hut       GSHSLKYGKTDAYVESVEVVLADGTVTEFGEVTLE--ELQDSAD---PDG-DLEAQIHAE
7284|gene|hma       GAHSLKYGKTDAYIEECEVVLADGTRTTFGWVDVE--DIEARAAEAGPDA-DLETRIYAE
5274|gene|hhi       GAHSLKYGKTDAYIEECEVVLADGTQTTFGWVGVD--DLKARAAEAGPDA-DLETRIYAE
12334|gene|hma      GAHSLQYGKTDAYIEECEVVLADGTVTTFGEVTRE--ELRDRAD---PDG-DLEARIYAE
2779|gene|hhi       GAHSLQYGKTDAYIEECEVVLADGTVTTFGELTRE--ELRDRAA---PDG-DLEGQIYAE
1400|gene|hla       GSHSLKYGKTDHYVEELEVVLADGTVTTFGEVAVE--ELRESAD---AESDDLLPRIHAE
2550|gene|hwa       GAHSLQYGKTDYYLETVEVVLADGTVTTFGEVTMD--TLHQRGD---PDG-DIEAQIYAM
15140|gene|hbo      GAHSLKYGKTDYYLESVEVVLADGSVTTFGEIEVE--TLREEGD---PDG-SLEERIYAE
                    *:**: *  :* * :   .**:**:      :                .  .    ::  

210|gene|hla        TRKLVEENEAEIDEKYPNLKRSVSGYNLHKVIYE----------------NDDGEDVINL
30510|gene|hbo      VRAVVEDNADEIEARYPDLKRRVSGYNLDRVVYE----------------NDAGERVMNL
11967|gene|hma      VREVVEENANEIEDRYPDLKRRVSGYNLDRVIYE----------------NDDGERVLNL
2478|gene|hhi       VREVVEENASEIEDRYPDLKRRVSGYNLDRVIYE----------------NDDGERVLNL
1452|gene|nph       LYRIASEEAEPVETAYPELKRNVSGYNLDCLIEQYEAAV----------AGDRET--VNL
2422|gene|nrc1      LRRLLDEEADRIRERFPDLKRNVSGYNYDRLLADA---------------EAHGA--VNA
2438|gene|hut       VSRILDEETETIDERFPDLKRNVSGYNLDRLVEE----------------ADDGT--VNL
7284|gene|hma       VAKILSEDATEIDARYPELKRNVSGYNLDELVDSA---------------RERGE--VNL
5274|gene|hhi       VAKILAEDAAEIDDKYPDLKRNVSGYNLDELVDSA---------------RERGE--VNL
12334|gene|hma      IERILAEEGEEIESHYPDLKRNVSGYNLDWVLDD----------------AQDGT--INV
2779|gene|hhi       IERILAEEDEEITSHYPDLKRNVSGYNLDWVLED----------------AQDGT--VNV
1400|gene|hla       IVRILDEEAGAIDERFPEMKRNVSGYNLDRLLAEYRGEY-----------GEAGV--VNL
2550|gene|hwa       VAQILTNHADEIASKYPNLKRNVSGYNLDMLVDELRGERRLPDNSAIDPQSEPGS--VNL
15140|gene|hbo      VARILDDEADEISERYPDLKRNVSGYNLDVLVDEMRGERRLPDDSGIDPESEPGT--VNL
                       :  :    :   :*::** *****   :: .                       :* 

210|gene|hla        SKLFVGAEGTLGTIVEAEVSLVSRPEETALALYTFDSLVDAMKAVPEALEFPVSAVELMD
30510|gene|hbo      ATLFVGSEGTLGVIVEAELSLVTVPEETALALYCFDDLVTAMEAVPVALEYDVSAVELMD
11967|gene|hma      AKLFVGSEGTLGVIVEAELSLVTVPEETALALYCFDTLPDAMRAVPVALDYDVSAVELMD
2478|gene|hhi       AKLFVGSEGTLGVIVEAELSLVTVPEETALALYCFDTLPDAMRAVPVALDYDVSAVELMD
1452|gene|nph       ARVLAGSEGTLGVVTEATVGLEPTPETKAVALLSYPGLIDALEDVEPILSFGPAAVEVLD
2422|gene|nrc1      ARLLAGSEGTLGIITEAEVSLEPVPAETAVAMLTYDDVRDAMQDVAPVLDHDPSAVEVMD
2438|gene|hut       ARLLAGSEGTLAVITEAEVSLEPVPETKSIALLAYESLIDAMEDVSIILEHDPSALEVLD
7284|gene|hma       ARLLAGSEGTLAVVTEAIVSLEPVPDATAVAMLTYDDIISAMQDVAPILDHDPSAVEVMD
5274|gene|hhi       ARLLAGSEGTLAVVTEATVSLEPVPQATAVAMLTYDDILSAMRDVAPILDHDPSAVEVMD
12334|gene|hma      ASLLAGSEGTLAIVTEAEVSLEPIPETKSMGLLAYEGLIEAMEDVADILEHDPAAVEVLD
2779|gene|hhi       ASLLAGSEGTLAIVTEAEVSLEPIPETKSMALLTYDGLIEAMEDVADILEHDPAAVEVLD
1400|gene|hla       GRLMAGSEGTLATVTEATVSLVEIPETKAVALLTYDDLLDAMEDVAPILDHDPAAVEVMD
2550|gene|hwa       ARLLAGSEGTLATVTQATVSLASIPETKSVALLTYDDVIGAMEDVAPILEHDPAAVEVMD
15140|gene|hbo      ARLLAGSEGTLGIVTEATVSLEPVPNTAAVALLTYDDVLDAMEDVAPILEHDPAAVEVMD
                    . ::.*:****. :.:* :.*   *   ::.:  :  :  *:  *   *..  :*:*::*

210|gene|hla        DEVFDLAAGSQEFAQYAE-PIPDRATAALMLEWDSELVDDFEAAIADTNAHFVEEGD---
30510|gene|hbo      DEVFRLAANSDGYAEYVE-PIPEGTDAALLLEFDSELHDDFEAAIDATTERFIHDGA---
11967|gene|hma      DEMFRLAAGSDGYAEYVD-PIPDRAAAALMLEYDSELHDDFEAAIARTNERFLDNGA---
2478|gene|hhi       DEMFRLAAGSDGYAEYVD-PIPDRAAAALMLEYDSELHDDFEAAIARTNERFLDNGA---
1452|gene|nph       DVLLDLARDTSEFGALVEETLPSDAGSVLLVEFYAESDADGKRRVAELLADRRPSAETT-
2422|gene|nrc1      DVFLDLARDTDEFADVVG-LLPDGTDSTLLVEFYADSPAEARRRVADLLADRLPSATPA-
2438|gene|hut       DTLLELAGKTEEFGPLVAEMVPEGTGAMLLVEFYADSDEAGRQKVADLIADRVPDGDSE-
7284|gene|hma       DVLLDLAAETPEFADVVS-MLPEETDSTLLVEFYADSPDDGAQKVADLLADRLPGYDAR-
5274|gene|hhi       DVLLDLAAETPEFADVVG-MLPEETDSTLLVEFYADSADDGAQKVADLLADRLPDYDAR-
12334|gene|hma      DVLIDLAQDTAEFEDVVG-MLPEGTRAVLIVEFYADDEESGRQKVADLLVDRTNGVDPA-
2779|gene|hhi       DVLIDLARDTAEFEDVVG-MLPEGTRTVLIVEFYADDAESGRRKVADLLADRTNGVDSI-
1400|gene|hla       DVLLGLAADTPEFEGVVG-MLPEGTDSVLLVEFYADSDVDGKQKVADLIADRVGATADRA
2550|gene|hwa       DVLLDLARETAEFEDVVG-LLPDGTDAVLLVEFYAETNEHGRQQVADLVADRVSGDETE-
15140|gene|hbo      DVLLDLARETPEFEEVVG-MLPEGTDSVLLVEFYADDADHGRQQVADLVADRVPNGESE-
                    * .: **  :  :   .   :*. : : *::*: ::        :               

210|gene|hla        ---------------------AFDVLEAYTPEDQEDLWKLRKAAIPLLMSMQGDPKPYPF
30510|gene|hbo      ---------------------AFEVVEAYTDADQADIWKLRKAAIPLLMSLEGDAKPYPF
11967|gene|hma      ---------------------AFDVVEAYTDADQADLWKLRKAAIPLLMSMDGDPKPYPF
2478|gene|hhi       ---------------------AFDVVEAYTDADQADLWKLRKAAIPLLMSMDGDPKPYPF
1452|gene|nph       -----ADSTGGPT--TDAPVRAIHADEAHEKADRERFWKLRKSGLPILLGRTTDEKHISF
2422|gene|nrc1      -----ADP-PGAT-TTDAPVHAVDALEAYDDDRQAHFWKMRKAGLPILLSRTSDEKHYPY
2438|gene|hut       -----LDPSEGASEITDEPHYAFDAQEAHADDERKRFWKLRKSGNPILLGRTTDEKHISF
7284|gene|hma       -----ESPSEEASSVTDAPVHAVDALEAYDADRQAKFWKMRKAGLPILLSRTGDDKHWPF
5274|gene|hhi       -----ESPSEGAAAVTDAPVNAVDALEAYDADRQAKFWKMRKAGLPILLSRTGDDKHWPF
12334|gene|hma      -----ADPTADRT-VVDTPIRAFDAMEAHDEAKREKFWKMRKSGLPILLSRTTDEKHGSF
2779|gene|hhi       -----AAPTDGRT-VVDAPVRAFDAMEAHDEAKREKFWKMRKSGLPILLSRTTDEKHGSF
1400|gene|hla       RPATMAEPSDGAAETTSQPRRAVDAMEAHDPEKRDRFWKMRKAGLPILLSRTTDEKHISF
2550|gene|hwa       -----AEPNPGAASITTTDQTAIQSMEAHDAETREKFWKMRKSGLPILLSRTSDEKHIAY
15140|gene|hbo      -----ADPSAGAAETTTKPHTAVTAMEAYDAETRAKFWKMRKSGLPILLSRTTDDKHIAY
                                         *.   **:    .  :**:**:. *:*:.   * *  .:

210|gene|hla        IEDATVPPEELAEYVGQFEEVLTDHDTSAAYFAHAGSGTLHIRPILSLKEEEGVEKMHSI
30510|gene|hbo      IEDATVPPAELAAYVQKFEAVLDDHDTSAAYFAHAGSGTLHIRPILNLKSESGVEDMHSI
11967|gene|hma      IEDATVPPAELAEYVEKFEEVLADHDTSAAYFAHAGSGTLHIRPILNLKEESGIEDMHSI
2478|gene|hhi       IEDATVPPAELAEYVEKFEEVLADHDTSAAYFAHAGSGTLHIRPILNLKEESGIEDMHSI
1452|gene|nph       IEDTAVPPENLPEYVAEFRELLEANDTFASFYAHAGPGCLHIRPLVDTKTTAGIEQMDAI
2422|gene|nrc1      IEDTAIPADHLPAFVADFQAILDDLDTVASYYAHAGPGVLHVRPLVTLADEAGVAKMAEI
2438|gene|hut       IEDTAVPPENLPEYVADFQDLLEDVGTFAAFYAHAGPGCLHIRPLVNTKTTEGIEQFEAI
7284|gene|hma       VEDTAVPAENLPEYIADIRELFDEHDTFASYYAHAGPGVLHIRPLLNLKSGDGIETMEAI
5274|gene|hhi       VEDTAVPAENLPEYVADIRELFDEHDTFASYYAHAGPGVLHIRPLLNLKSGDGIETMEAI
12334|gene|hma      IEDTAIPPANLPEYVADFQEILEEHDTFASFYAHAGPGVLHIRPLINTKSVEGVETMESI
2779|gene|hhi       IEDTAIPPANLPEYVADFQEILEEHDTFASFYAHAGPGVLHIRPLINTKTVEGVETMESI
1400|gene|hla       IEDCAIPPEHLPEYTREFQEILDDNDTFATFYAHAGPGVLHIRPLINTKDVDDVDAMVDI
2550|gene|hwa       IEDTAIPAENLPAYVSDFQDILDEHDTFASYYAHAGPGVLHIRPLVNTKTAEGVETFESI
15140|gene|hbo      IEDTAIPAGNLPAFVSDFQDILDDHDTFASYYAHAGPGVLHIRPLVNTKTVEGLETYETI
                    :** ::*.  *. :  .:  ::   .* *:::****.* **:**::      .:     *

210|gene|hla        SEDVTDLVLEHHGAFSGEHGDGLARTEFNPKMYGEALWSAFQELKSTFDSEWRMNPGKVV
30510|gene|hbo      TDDVTDLVLEHHGSFSGEHGDGMARTEFNPKMYGETLWDAFKRVKTAFDPEWWMHPGNVV
11967|gene|hma      TDDVTDLVLEHNGSFSGEHGDGMARTEFTPKMYGETLWDAFKQVKTAFDPQWWMHPGNVV
2478|gene|hhi       TDDVTDLVLEHNGSFSGEHGDGMARTEFTPKMYGEDLWDAFKQVKTAFDPQWWMHPGNVV
1452|gene|nph       AEGATDLVAEYDGSVSGEHGDGRARTRWNRKLYGDEVFGLFEELKAAFDPDGILNPEQVC
2422|gene|nrc1      ADRVTDLVVEYGGAVSGEHGDGRARSQWNRKFYGEDLWASFRRTKAAFDPDWILNPGPVC
2438|gene|hut       AEGATDLVVEYGGSVSGEHGDGRARSQFNRKLYGDELWETFEELKTAFDPDWLLNPGNIC
7284|gene|hma       SDAITDLVVQYDGSVSGEHGDGRARTQWNRKLYGDDLWETFRDLKSAFDPDWRLNPGNIC
5274|gene|hhi       SDAITDLVVQYDGSVSGEHGDGRARTQWNRKLYGDDLWETFRDLKTAFDPDWRLNPGNIC
12334|gene|hma      ADAVTDLVVKYGGSVSGEHGDGRARTQWNEKLYGPDLWETFQELKSAFDPDWLLNPGQVV
2779|gene|hhi       ADAVTDLVVKYGGSVSGEHGDGRARTQWNEKLYGADLWETFQELKSAFDPDWLLNPGQVV
1400|gene|hla       ADRVTDAVVRLGGSVSGEHGDGRARTQWNRKLYGDDLWDAFRDLKTAFDPDWLLNPGNVC
2550|gene|hwa       ADAVTDLVVKYGGSISGEHGDGRARTQWNRKLYGDELWDVFRELKSAFDPQWLLNPGNIC
15140|gene|hbo      ADEVTDLVVKYGGSVSGEHGDGRARTQWNRKLYGDELWATFRDLKTAFDPDWLLNPGNIC
                    ::  ** *    *:.******* **: :. *:**  ::  *   *::**.:  ::*  : 

210|gene|hla        YVDGETADERGYPDTAADTDMRENLRYGPAYQ---SIEPQTTLDFSEEGGFSHLVELCNG
30510|gene|hbo      Y-RSGADDIGPDSDRGVGADMREHLRYGAQYQ---SIEPQTTLDFTDEGGFSQLVELCNG
11967|gene|hma      Y-RDGPADIGPDADRGVGADMRENLRYGPDYQ---SLEPQTTLDFEDEGGFSELVELCNG
2478|gene|hhi       Y-RDDPDDIGPDADRGVGADMRENLRYGPDYQ---SLEPQTTLDFADEGGFSELVELCNG
1452|gene|nph       G----------------DVDPTEALRFDPDYEFDPGFEP--ALRWDNDNGFQGMAELCHG
2422|gene|nrc1      G------------DAAGEIDMTDHLRVAPDDEFDAGFDP--ALNWDTENGFRGMTELCHG
2438|gene|hut       G----------------DHDMTENLRFSPEYDFELGFDP--VLEWDNENGMQGMVELCHG
7284|gene|hma       G----------------EHDPAENLRYDPDYEFDAGFDP--ALDWDNENGFQGMVELCHG
5274|gene|hhi       G----------------DHDPAENLRYDPDYEFDAGFEP--TLDWDNENGFQGMVELCHG
12334|gene|hma      GVDAGEVESGAMPERARTVDMTENLRFDPEYEFDAGFDP--ALEWDNDNGMQGMVELCHG
2779|gene|hhi       GVDAGEVESGAMPERARTVDMTENLRFDPAYEFDAGFDP--ALEWDNDNGMQGMVELCHG
1400|gene|hla       G----------------DHDMRENLRFDSEYEYDAGFDP--AMEWAIDNGMQGMVELCHG
2550|gene|hwa       G----------------EHAPTANLRFDPEYEFDAGFEP--TMNWEVENGFEGMAELCHG
15140|gene|hbo      G-YQADEERPAGAAATSAHEMTEHLRFSPDYDFDAGFDP--ALNWENENGFQGMAELCHG
                                            **  .  :   .::*  .: :  :.*:  :.***:*

210|gene|hla        CGTCR---EVDSGVMCPTYRASEEEIQATRGRANMLRAAISGELDDDEIHSDRFQEEVLG
30510|gene|hbo      CGTCR---QTGQEVMCPTYRASREEVQTTRGRANLLRSAISGDLRPDEIHSERFQEEVLD
11967|gene|hma      CGTCR---QTDGDVMCPTYRASEEEVQTTRGRANLLRSAISGDLDEDEIHSDRFQEEVLD
2478|gene|hhi       CGTCR---QTDGDVMCPTYRASEEEVQTTRGRANLLRSAISGDLSEDEIHSDRFQEEVLD
1452|gene|nph       CGGCRGPQETTGGVMCPTYRAADEEIQSTRGRANALRAAASGRL-DAAATDPEFMREVLD
2422|gene|nrc1      CAGCTGHQDTTGGVMCPTYRAANEETLSTRGRANMLRSAMNGHL-PADPLDDEFLTEVLD
2438|gene|hut       CGGCRGPQETTGGVMCPTFRASEEEVTSTRGRANMLRQAMSGDL-PADVTDEEFMTEVLD
7284|gene|hma       CAGCTGHQETTGGVMCPTYRAAEEEITSTRGRANMLRSAMDGDL-PDDPFEEEFVTEVLD
5274|gene|hhi       CAGCTVHQETTGGVMCPTYRAAEEEITSTRGRANMLRSAMDGDL-PEDPTDEEFVTEVLD
12334|gene|hma      CGGCRGPQETTGGVMCPTYRASEEEMTTTRGRANMLRQAMSGDL-PDDPTDEEFMHEVLD
2779|gene|hhi       CGGCRGPQETTGGVMCPTYRASEEEMTTTRGRANMLRQAMSGDL-PDDPTDEEFMHEVLD
1400|gene|hla       CGGCRGPQETTGGVMCPTYRASEEEIQATRGRANMLRGAMNGEL-PDDPTDDEFVTEVMD
2550|gene|hwa       CGGCRGPQETTGGVMCPTYRAAEEEIQSTRGRANMLRQAMSGSLDENELFEDEFVEEVLD
15140|gene|hbo      CGGCRGPQETTGGVMCPTFRAEEEEILSTRGRSNMLRQAMSGDLSPEEQFEDEFVEEVTD
                    *. *    :.   *****:**  **  :****:* ** * .* *      .  *  ** .

210|gene|hla        LCVGCKGCKSDCPTGVDLAKLKAEVKHEHHEEEGSGLRERIFRDIDRFSAIGSALAPVSN
30510|gene|hbo      LCIGCKGCKSDCPTGVDMAKLKAEVKHQHHQARGIGLRERLFANIDTASKVGSMLAPLSN
11967|gene|hma      LCVGCKGCKSDCPTGVDMAKLKTELKHQHHEAEGASLRERLFANIDTASKLGSALAPISN
2478|gene|hhi       LCVGCKGCKSDCPTGVDMAKLKTELKHQHHEAEGASRRERLFANIDTASKVGSALAPVSN
1452|gene|nph       LCIGCKGCSNDCPSEVDLAKLKAEVTYQHHREHGASLRDRLFANIDTVAALGSRLAPLVN
2422|gene|nrc1      LCVGCKGCKLDCPSGVDMAKLKTEVKHASHQADGVGVLDRLFGHTEALFHLGSALAPVSN
2438|gene|hut       LCIGCKGCAKDCPSEVDMAKLKAEVTHQYHQEHGSSLRDKIFANVDRLLPLGSALAPISN
7284|gene|hma       LCIGCKGCKKDCPSGVDMAKLKAEVVHEHHQREGISLRDRLFANVETVLSLGSTFAPVSN
5274|gene|hhi       LCIGCKGCKKDCPSGVDMAKLKAEVVHEHHQREGISLRDRLFANVETVLSLGSAFAPMSN
12334|gene|hma      LCIGCKGCAKDCPSEVDMAKLKAEVTHAYHQEHGSSLRDKVFANVDALAGLGSSFAPLSN
2779|gene|hhi       LCIGCKGCAKDCPSEVDMAKLKAEVTHAYHQEHGSSFRDRIFANVDALAGLGSAFAPLSN
1400|gene|hla       LCVGCKGCTKDCPSGVDMAKLKAEVEHAHHEEHGIDLRTRLLGNFESLAPIGSTLAPLSN
2550|gene|hwa       LCIGCKGCAKDCPSGVDMAKMKAEITHEYHQRNGSSFRDKLFANVTTVLKLGSKFAPLSN
15140|gene|hbo      LCIGCKGCMKDCPSGVDMAKMKAEVTHEYHQRNGSSLRDKMFANIDTLSKLGSAFAPLSN
                    **:*****  ***: **:**:*:*: :  *   * .   .::        :** :**: *

210|gene|hla        AATKIPGARAVMDAVAGIAPDRELPTFRSESFEEWFASRGGSTIDPAEAVDTVALFPDTY
30510|gene|hbo      WATKLPGVRTAMQKALGIAPERELPPFRRETLRDWFESRGGSTVERTDANARVVLFPDTY
11967|gene|hma      WATDIPGARAVMQKLFGIAPERELPTFSRETLQDWFDARGGSTVSRAEADRKVLLFPDTY
2478|gene|hhi       WATDIPGARTVMQKLFGIAPERELPTFSRETFQDWFDARGGSTVSRAEADRKVLLFPDTY
1452|gene|nph       RLSSLPGSGRIAEKALGIARERSPPTFERESFVDWFERRD-PTVAVSETDHRVVLLPDTF
2422|gene|nrc1      WATALPGAGALAEKTLGIAAERDLPTFRRESLRAWFDARGGSRVPEAAAEHTVLLAPDPY
2438|gene|hut       WAQRLPGRGIIQEKVLGIARERKFPTFYRETFVDWFASHE-PQVSAAEADRKVLLFPDTF
7284|gene|hma       WLMDLPGSGLLMEKTVGITEERTLPGFHRTTFRDWWADRGGAMVAASKADRKALLLADPY
5274|gene|hhi       WLLDLPGSGLLMEKTVGITEERTLPAFHRTTFRDWWADRGGALIAANKAERKALVIADPY
12334|gene|hma      LATKVPGARTVLEKAVGIAPDRTLPSFQRTTLQDWFDERG-PQIPADEAERRALLFPDTY
2779|gene|hhi       LATKVPGARTVLEKTVGIATDRTLPTFRRTTLQDWFDDRG-PQVPADEAERQALLFPDTY
1400|gene|hla       LPGKIPGAGLVMEKALGIAKERDLPTFRSESLTDWFEARGGAGIPRAEADRDVLLFPDVY
2550|gene|hwa       LAQQVPGSGILQEKLLGIARERTLPPFHRRSFVDWFEQRGGAAIPADEATHRVLLFPDTY
15140|gene|hbo      LAANVPGARLLMEKTLGISRERELPQFSRESFVDWFKSRGRAGIPEAQAESKVLLFPDTY
                        :**     :   **: :*  * *   ::  *:  .  . :    :   . : .* :

210|gene|hla        TNYSYPAAGKAAVEVLEAAGVRVEVPDDLAPSGRAAFSTGFLNDARERAATNVAALAPRV
30510|gene|hbo      TNYSYPAAGKAAVTVLEAADVHVSIPDDTAPSGRAAYSTGMLDRAKERAQSNTDRLVGQV
11967|gene|hma      TNYSYPTAGKAAVETLEAAGVHVTIPDNTAPSGRAAYSTGMLDVARDRAETNTDRLADRV
2478|gene|hhi       TNYSYPTAGKAAVETLEAAGVHVTIPDNTAPSGRAAYSTGMLDLARERAETNANRLSDRV
1452|gene|nph       TNYVDTDVAKAAVRVLEAAGVHVDIVE-AGGTGRAAYSKGFVETAAERAQDTVEAVEPYV
2422|gene|nrc1      TNYSTVAVGKAAVRVLEAAGVHVALPDGVGTSGRPAYSRGLIDRTRRIARENVAALAPKV
2438|gene|hut       SNYNRPQAGKEAVRVLEAAGVHVDVPSDVTDSGRAANSKGFLDKAKEHASENVETLAPRV
7284|gene|hma       TNYSHPDVGKAAVEVLEAAGVHVVVPDGVTDSGRPAFSKSMLDHARETAQANVDALAPRI
5274|gene|hhi       TNYSHPDVGKAAVEVLEAAGVHVVVPDGVTDSGRPAFSKSMLDHARETARANVDVLAPRI
12334|gene|hma      TNYSHPEVGKAAVRVLEAAGVHVQLAD-RTDSGRPAHSKGFLDQSRATARDNIDALVPAV
2779|gene|hhi       TNYSHPEVGKAAVRVLEAAGVHVQLAN-RTDSGRPAHSKGFLDQSRATARDNVDALVPAI
1400|gene|hla       TTYTNPGAGKAAVRVLEAANCHVRIPD-VDGSGRPPHSKGMLDESRAAARDAVETLVPDV
2550|gene|hwa       TNYNHPEAGQAAVNALESLGVHIQIPDDVTGSGRPPHSKGFLEKARESAQTNINALSPRI
15140|gene|hbo      TNYNHPEAGKAAVRALEAAGVHVRIPDGVTGSGRPPHSKGFIDRAREQARQNVEALAPLV
                    :.*    ..: ** .**: . .: : .    :**.. * .::: :   *      :   :

210|gene|hla        RDGQSVVFVEPSDAVMFQDEYLDLLDGD-------DVEAVSAAAYGVLEYLDAGRVDEQL
30510|gene|hbo      EDGWDIVFVEPSDAVMFQDEYCNLLDGQ-------RVEQVAGSSYGVLEYLDVLRLDESL
11967|gene|hma      TEGWDIVFVEPSDAVMFQDEYLDLLDGS-------AVSQVADSAYGVLEYLDTFRLDDAL
2478|gene|hhi       AEGWDIVFVEPSDAVMFQDEYRDLLDGP-------EVSRVAESAYGVLEYLDTFRLDDAL
1452|gene|nph       EDGWSVVVCEPSDAVMVQSDYASLLPEA-------TVEHVAENTYGVCEYLDVAGLDGGV
2422|gene|nrc1      ADGWDVVYVEPSDAVMVQDDYHDLLSSA-------PAASVAANTYGVCEYLDRHGLDAAA
2438|gene|hut       ADGWDVVSIEPSVAVMFQLDYLDLLGGR-------DAETVANNTYGIFEYLDTHGLVEEI
7284|gene|hma       RDGWDVVTIEPSDAVMYQVDYCDLLSGD-------DVDTVAENTYGICEYLDTYRLGETI
5274|gene|hhi       RDGWDVVTIEPSDAVMYQVDYRDLLSGD-------DVDTVAANTYGVCEYLDTYRLGEAI
12334|gene|hma      KEGWDVVLVEPSDAVMFQSDYLDLLSGE-------DVETLAANAYGVCEYLDTFRLDEAA
2779|gene|hhi       EEGWDVVLVEPSDAVMFQSDYLDLLSGE-------DAETLAANAYGVCEYLDTFRLDQGA
1400|gene|hla       ADGWDVVVVEPTDAVMLQTDYHDLLDGDASDVPDADVATVSANTYGVMEYVDAHRLDEDI
2550|gene|hwa       ADGWDVVVVEPSDAVMFQRDYLDLLSGS-------DVERVAENTYGVMEYIDTFRLLADA
15140|gene|hbo      REEWDVVVVEPSDAVMFQHDYLDLLSGE-------DVEAVAANTYGVMEYFDTFRLLERD
                     : ..:*  **: *** * :* .**           .  ::  :**: **.*   :    

210|gene|hla        AFD----APAESLTYHGHCNQKATNKDHHAVGVLRRAGYDVDPLDSSCCGMAGSFGYESE
30510|gene|hbo      PVDDRSLGAAGTLSYHGHCNQKGTNKDHHAVGVLRRVGYDVDPLDTTCCGMAGSFGYHDE
11967|gene|hma      PVEDRSLGAAGAVSYHGHCNQKGTNKDHHAVGVMRRVGYEVDPLDSTCCGMAGSFGYHDE
2478|gene|hhi       PVEDRSLGAAGAVSYHGHCNQKGTNKDHHAVGVMRRVGYEVDPLDSTCCGMAGSFGYHDE
1452|gene|nph       PTD----AGGEQLVYHGHCHQKATKRDHHAVGVLRRAGYDVTPLDSTCCGMAGSFGYEAE
2422|gene|nrc1      GFD----ADGESLAYHGHCHQKAQQRDHHAVGVLRRAGYEVDPLDSTCCGMAGSFGYEAE
2438|gene|hut       EVD----PSDRPLTYHGHCHQKAIKKEHFTAEVLEDVGFTVDALDSSCCGMSGSFGYEAE
7284|gene|hma       PFD----ESGDSLAYHGHCHQKATKKDHHAVGVLRRAGYAVDPLDSGCCGMAGSFGYEAE
5274|gene|hhi       SFD----EPGGSLAYHGHCHQKATKKDHHAVGVLRRAGYAVDPLDSGCCGMAGSFGYEAE
12334|gene|hma      DWD----VPAETLTYHGHCHQKATKKDHHAVGVLRRAGYDVDPLDSGCCGMAGSFGYEAE
2779|gene|hhi       DWD----APGETLTYHGHCHQKATKKDHHAVGVLRRAGYDVDPLDSGCCGMAGSFGYEAE
1400|gene|hla       DLD----APTESLTYHGHCHQKATKKDHHAVGVLRRAGYGVDPLDSSCCGMAGSFGYEAE
2550|gene|hwa       GHTNMVNGTAPSLTYHGHCHQKSTKKDHHTVGVLRRAGYEVDPLDSTCCGMSGSFGYEAE
15140|gene|hbo      VVE--TNDASASLTYHGHCHQKSTKKDHHAVGVLRRAGYRVDPLDSTCCGMAGSFGYEAE
                                : *****:**. :.:*.:. *:  .*: * .**: ****:*****  *

210|gene|hla        HYDISKAIGRILFDQVEESGGETVTAPGASCRSQLGDRDGAEN---PPHPIEKVAEAVTG
30510|gene|hbo      HYALSKAIGSILFDAVDASDGDRVVAPGGSCRSQLGDREGANGI--PQHPIEAVADRL--
11967|gene|hma      HYDLSKTIGRLLFDKVEESDGDRVVAPGGSCRSQLGDRDGVDEI--PPHPIEVVAERVPE
2478|gene|hhi       HYDLSKTIGRLLFDKVEESDGDRVVAPGGSCRSQLGDRDGVDEL--PPHPIEVVAERLPD
1452|gene|nph       HYSMSQAIGSLLFDRLDDADG-RPVAPGASCRTQLS--GDGRT---AVHPIECLAAAIPE
2422|gene|nrc1      HYSMSQAIADILADQVADSDADTVTAPGSSCRSQLSERDDVDTDGAPPHPVQKLADAL--
2438|gene|hut       HYSLSQAMGDILFDQIRESSGERVIAPGASCRHQIGEHEGASDD--PPHPIEVLAADLQE
7284|gene|hma       HYSMSEGIADLLLGQIDDSPAEQVVAPGASCRSQIDDFGDGETE--PPHPIEMVAAAIQ-
5274|gene|hhi       HYSMSEGIADLLLGQIDDSPAERVVAPGASCRSQIDDFGDGDAE--PPHPIEMVAAALQ-
12334|gene|hma      HFSMSKAIGAILFDQIGESRGDTVVAPGASCRTQLDDWDESDGE--PPHPVEKLDAALA-
2779|gene|hhi       HFSMSKAIGSILFDQIGESRGNTVVAPGASCRTQLDDWDESDGE--PPHPVEKLDAALA-
1400|gene|hla       HYSMSKAIGRILFDQVAESDGDEVVAPGASCRSQLKERDGGAPE--PPHPVEKLAAALA-
2550|gene|hwa       HYSMSQAIGEILFDQIDDSDGDVVIAPGASCRSQIGDRPDGDD---PPHPVELLADAVTE
15140|gene|hbo      HYSMSKAIGEILYDQVENADGEMVVAPGASCRSQLGDRDDETE---PPHPVEMLADAVA-
                    *: :*: :. :* . :  : .    ***.*** *:           . **:: :   :  

210|gene|hla        AASDAVADAGAAEAASPSPADD
30510|gene|hbo      ----------------------
11967|gene|hma      TTTS------------------
2478|gene|hhi       TATTSRSA--------------
1452|gene|nph       PNR-------------------
2422|gene|nrc1      ----------------------
2438|gene|hut       ----------------------
7284|gene|hma       ----------------------
5274|gene|hhi       ----------------------
12334|gene|hma      ----------------------
2779|gene|hhi       ----------------------
1400|gene|hla       ----------------------
2550|gene|hwa       ----------------------
15140|gene|hbo      ----------------------