HOG Organism Gene ID Name Annotation
aHOG1483 hhi 1620 HAH_1620 hypothetical protein
aHOG1483 hbo HBOR13790 Hbor_13790 hypothetical protein
aHOG1483 hla HLAC2197 Hlac_2197 hypothetical protein
aHOG1483 hmu HMUK2211 Hmuk_2211 conserved hypothetical protein
aHOG1483 nph NP2998 hypothetical protein
aHOG1483 nrc1 VNG1423 vng1423 no entry
MUSCLE (3.6) multiple sequence alignment


1423|hp|nrc1      MRDEEEIREQYEFLVEELESEEMSHEGIREMFTYYRRALGWALEEEHM
13790|hp|hbo      MRTEEEIREQYEFLEEELASEEMRHSGVKELFTHYKRALGWVLEEEHM
2998|hp|nph       MRDEEEIREQYEFLKEELDDEDMNHEGVRQMFTYYKRALGWVLEEEYI
1620|hp|hhi       MRSEDEIREQYEFLAEQLDDEEMDHERVRMMFTHYKRALGWVLEEEHI
2197|hp|hla       MRSEDEVREQYEFLREQLDDEEMHHRGVEELFTHYKRALGWVLEEEHM
                  ** *:*:******* *:* .*:* *  :  :**:*.*****.****::