HOG Organism Gene ID Name Annotation
aHOG1474 hhi 1616 HAH_1616 hypothetical protein
aHOG1474 hbo HBOR14160 Hbor_14160 hypothetical protein
aHOG1474 hmu HMUK2202 Hmuk_2202 conserved hypothetical protein
aHOG1474 hut HUTA2940 Huta_2940 conserved hypothetical protein
aHOG1474 nph NP4220 hypothetical protein
aHOG1474 hma Hma_10989 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


4220|hp|nph       MGLEDLSDDIETAYSDLGEELSVDLDTETRNELAMLQSAYEPDDPDELVRRAVHMLFQTA
14160|hp|hbo      MGLDELTEDVETAYADLDEESTVSFDRETRHELAMLAAAFETDETDELVRRAVHLLFQTT
2940|chp|hut      MTLDALSDDVTAEYGALGEEIAVDLDRETRNELAMLETALEPESTDELLRRAVHMLFQST
1616|hp|hhi       MSLDDLQEDIEAAYGDFDDDFELSIDRETRNELAMLSVALDPDDPDELVRRAVHMLFQST
10989|hp|hma      MSLEDLQEDIEAAYGDFDDEFALSIDRETRNELAMLSVALDPDDPDELVRRAVHMLFQST
                  * *: * :*: : *. :.::  :.:* ***:*****  * :.:..***:*****:***::

4220|hp|nph       IETGNLDFHLRSGYDVTYDEYLSGMTFEEMGGGSDLFGQNDDNARRYQF
14160|hp|hbo      VDRGTLDFHLRQGYDVTYDEYLSGMTYEEMTGQNQYPQR--DDERRYQM
2940|chp|hut      VDTGTLDFHLRSSYDVTYDEYLSGMTYDEMTGANQFPQQGDPDDRRYQF
1616|hp|hhi       VDRGTLDFHLRSSYDCTYDEYLSGMTFDQMTG-NDFPQQQDKDDRRYQF
10989|hp|hma      VDRGTLDFHLRSSYDCTYDEYLSGMTFDQMTG-NDFPQQQDKDDRRYQF
                  :: *.******..** **********:::* * .:   .   : ****: