HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0147COG1199KOG1133 KOG1131 KOG1132arCOG00770Rad3-related DNA helicasesrad3 related DNA helicase

HOG Organism Gene ID Name Annotation
cHOG0147 nrc1 VNG2476 rad3c rad3 related DNA helicase
cHOG0147 hmu HMUK1203 Hmuk_1203 helicase c2
cHOG0147 hma RRNAC2901 uvrB putative uvrB
cHOG0147 hwa HQ3436A dinG Rad3-related DNA helicases DinG
cHOG0147 hla HLAC2213 Hlac_2213 helicase c2
cHOG0147 hbo HBOR01230 Hbor_01230 DNA helicase, Rad3-like
cHOG0147 hut HUTA1013 Huta_1013 helicase c2
cHOG0147 hvo HVO_0099 HVO_0099 conserved hypothetical protein
cHOG0147 nph NP0898A helicase-like protein
cHOG0147 hhi 170 HAH_0170 helicase c2
MUSCLE (3.6) multiple sequence alignment


2476|chp|nrc1       ---------------------------------------------------------MGC
1013|gene|hut       ---MDPSRIESAFPAPSYRGNQEDALRRIRAAFEAGNDVVLVRAPTGSGKSLLARAIAGC
3436|gene|hwa       --------------------MQAEAISDIRDAFAAGNSVVLVRAPTGSGKSLLARAIAGG
1230|gene|hbo       ---MDPDRILPSFPAPSYRGAQEQALCDIRDAFAAGNDVVLVRAPTGSGKSLLARSIAGA
2213|gene|hla       MAVVDPDRIPAEFPAPSFRGAQEQALADIRDAFAADNDVVLVRAPTGSGKSLLARAIMGA
898|gene|nph        ---MDPSRIVAEFPAPSFRGAQQQALADIRAAFEAGNDVVLVRAPTGSGKSLLARAIAGC
12901|gene|hma      ------------------------------------------------------------
170|gene|hhi        ---MYPARITDEFPAPSYRGNQKQALADIRAAFESGKDVVLVRAPTGSGKSLLARAIAGC
                                                                                

2476|chp|nrc1       ARRAADADPSDAVGAYYTTPQVSQLDDVAADDLLEEFKLIRGKSNYTCILPGEEATPVDR
1013|gene|hut       ARQGSQASATDAIGAYYTTPQVSQLDDVAADPLLDDLSIIRGKSNYKCILSGETDTPVTQ
3436|gene|hwa       ARTATDAKPSDAINSYYTTPQVSQLDDVAADPLLDDLNIIRGKSNYTCILNGETETPVDR
1230|gene|hbo       ARTTEEAKPAQATDAYYTTPQVSQLDDVAEDELLEDLSIIRGKSNYTCILNGETDTPVDR
2213|gene|hla       SATVDETAPSEATGAYYTTPQVSQIDDVEADDLLDDLAVIRGKSNYDCILPGEHDTPVNR
898|gene|nph        ARQDGEGPPGLATGAYYTTPQVSQLDDVAGDDLLDDLSVIRGKPNYSCILPGETTTPVNQ
12901|gene|hma      ------------------------------------------------------------
170|gene|hhi        ARTAGEAAPEQVIDAYYTTPQVSQLDDVAEDALLEDLCVIRGKNNYDCILPGETDTPVNQ
                                                                                

2476|chp|nrc1       APCARERGYDCAVKHRCPYFADRAIASSRAFAAMTLAYFMRTAGSEVFRKRDVCVIDEAH
1013|gene|hut       APCAREREFDCQVKHRCPYFSDRSIAANQSIAAMTLAYFMQTAGSDVFGTRDVVVIDEAH
3436|gene|hwa       APCAREKGYDCSVRHRCPYFSDRAIASNRRIAAMTLAYFMQTAGSDVFRRRDVVVIDEAH
1230|gene|hbo       APCARQKGFDCTVRHRCPYFSDRAIASNRKIAAMTLAYFMQTAGSDVFRQRDVVVIDEAH
2213|gene|hla       APCVRQQGFDCSVKHRCPYFSDRAIASGNRYAAMTLAYFMRTAGSEVFRKRDVVVIDEAH
898|gene|nph        APCARERGFDCPVRHRCPYFADRATASENPIAAMTLAYFMQTAGSEVFGERDVVVVDEAH
12901|gene|hma      ---------------------------------MTLAYFMQTAGSDVFGKRDVVVIDEAH
170|gene|hhi        APCVRERKFDCQVKHRCPYFSDRAIASNRRIAAMTLAYFMQTAGSDVFGKRDVVVIDEAH
                                                     *******.****:**  *** *:****

2476|chp|nrc1       GLAEWAEMYATIDLDEQRVPVWEDVRVPSG------LDGDPERTADFADHLQGVCEGVKD
1013|gene|hut       GLGEWAEMYAAIDLAPDTVPVWDARPPPEI--------DDVETAADYAAGLSRVCDRRLT
3436|gene|hwa       GLPEWAEMYATVNLQSNTIPIWDDITVPDLTA----ESDPLDRTIRFAETVIEACKRATD
1230|gene|hbo       GLAEWAEMYATIDLNPNTVPVWDDVGVPNVTT----ADDPLERTVRFAEALLQVCSNAKD
2213|gene|hla       GLAEWAEMYATIELSPGRVPVWDEVGVPDVAADAGPEEDALDRTARFAASLRDTAKRAKD
898|gene|nph        GLAEWAEMYATIELSPSTVPVWDACRPPDV--------DGIADVDGYAERLLDVCSRRQT
12901|gene|hma      GLGEWAEMYATIDLSPQSIPMWNDIDVPDI--------DGLDEAVAFTERVEHLAERRVK
170|gene|hhi        GLGEWAEMYATIDLSPQSIPMWNDIDVPDI--------DGLDEAVSFTERVEHLAERRVK
                    ** *******:::*    :*:*:    *.         .    .  ::  :   ..    

2476|chp|nrc1       ELLGQDELTTEAVARRDRLQELIAELDWFIEDYRDPESATTWVVD-ADE------EG--V
1013|gene|hut       DLRAQVELEPEEAAERDRLEELRSDLTWFQEAVRDPDSPTTWVVDQPDG------EGGRT
3436|gene|hwa       SLINRDELTPTEAAHRDRLQEIRSELQWFISDARDPQSPTTWVIDQDDT------NN-DV
1230|gene|hbo       ELLTKSELTPEEASRRDRLQELRSELKWFIEDYRDPESPTTWVVDQFGG------EGEPI
2213|gene|hla       ELTGRPELDREEVARRDRLQELISELGWFLEDYRDSQSPTTWVVDQPDG------EGSAL
898|gene|nph        ELRGRAELTPDEAAERDRLAELRRDLQWFLDDRKDDDSPTVWVADQSDRGTRKDPRGGAV
12901|gene|hma      ELRKKAELTGEEVAERDSLNTLRQDLGWFREDYTDTESATTWVVDQADG------EHAPV
170|gene|hhi        ELRNKAELTGDEVAERDSLNTLRQDLGWFREDYTDTESATTWVVDQADG------ENAPV
                    .*  . **    .: ** *  :  :* ** .   * :*.*.** *  .            

2476|chp|nrc1       TIKPMDPERYLSHTVWDRANKHALLSATILNKAAFCRSVGLDPSTVALVDVEHTFPVANR
1013|gene|hut       TFKPLNPERFLSHTVWDRGNKFALLSATILNKDAFCASAGLDPGRVALVDLEHTFPVENR
3436|gene|hwa       AIKPLDPARYLSHTVWNRGNKFALLSATILNKNAFCRGVGLDPAEVALVDVDHTFPVANR
1230|gene|hbo       TAKPLDPARYLKHTVWDRGNKFALLSATILNKDAFCRGVGLDPSNVALVDVEHTFPVENR
2213|gene|hla       AIKPLDPARYLQHTVWDRGNKFALLSATILSKEAFCRGVGLNPANVALVDVEHTFPLSHR
898|gene|nph        TVKPLDPARYLHHTVWDRGNRFALLSATILDKEAFCRGAGLNPDTVALVDVPHTFPVENR
12901|gene|hma      TIKPMNPERYLKHTVWDRGNRFALLSATILNKEAFCANVGLDPSNVALVEVGHTFPVENR
170|gene|hhi        TIKPMNPERYLKHTVWDRGNRFALLSATILNKEAFCANVGLDPSNVALVEVGHTFPVENR
                    : **::* *:* ****:*.*..********.* *** ..**:*  ****:: ****: :*

2476|chp|nrc1       PLYDVTQGKMTYENRAQTLPKLADTVVRVMATHPDEKGIVHAHSYDIAEKLAARLADAGV
1013|gene|hut       PLVDVTQGKMTYEERDATIPKVAETLVSLMARHPEEPGLVHCHSYAIQDALADELDALGV
3436|gene|hwa       PLYDVTCGKMTYNERDETLPAVTRMLIRLMAAHPDEKGLIHCHSYAIQSSLRRRLAELGV
1230|gene|hbo       PLYDVTQGKMTYEHRDETIPKIARLLVRLMAKHPDEKGLVHCHSYAIQSELRKRLAQLGL
2213|gene|hla       PLYDVTQGSMTYEHRDETVPKIARLIVRLMAEHPDEKGLIHAHSYDIAGRLTELLGEFGV
898|gene|nph        PLYDVTQGKMTYEHREETLPKLARTVVRLMAAHGDEKGLIHAHSYAIADQLRELLSEFGV
12901|gene|hma      PLYDVAQGKMTYEHRDDTLPDIARTIVRIMARHTDEKGLIHCHSYAIQEQLKELLDDFGV
170|gene|hhi        PLYDVAQGKMTYEHRDDTLPDIARTVVRIMAQHTDEKGLIHCHSYAIQEQLKDLLDDFGV
                    ** **: *.***: *  *:* ::  :: :** * :* *::*.*** *   *   *   *:

2476|chp|nrc1       GDRVRTHDADTRDAELERWKASDDPEVFVAVKMEEALDLAHDLGRWQVLCKAPFLNTNDS
1013|gene|hut       GDRVRSHDSEDRDGQLAAWKRSDDPTVFLSVKMEEALDLDGDLCRWQLLCKAPYPNTRDS
3436|gene|hwa       ESRIQTHDTTDRDESLQAWLSTDSPDIFLSVTMEEALDLQGDLCRWQVICKAPYLNTTDS
1230|gene|hbo       GGRIRGHDKANRDAELETWKASSGADVFLSVKMEEALDLKGDLCRWQVICKAPYLNTNDS
2213|gene|hla       AARVRRHDRANRDAELAAWKASDDPEVFVSVKMEEALDLKGDLCRWQVVCKAPYRNTNDS
898|gene|nph        GGRVRGHDRDNRDAALAGWKRSDDPDVFISVKMEEALDLNGDYCRWQVLCKAPYPNTNDS
12901|gene|hma      GARVRTHDKEGRDGALSAWKRSDNPDVFLSVKMEEALDLEGDLCRWQVLCKAPYPNTRDS
170|gene|hhi        GARVRTHDKEGRDGALSAWKRSDNPDVFLSVKMEEALDLEGDLCRWQVLCKAPYPNTRDS
                      *:. **   **  *  *  :... :*::*.*******  *  ***::****: ** **

2476|chp|nrc1       RVAARLADGQWAWYYRTALQTIIQACGRVVRAPDDYGATYIADSSVLDVFERARGDMPPW
1013|gene|hut       RVARRLEDGDWAWYYRSALRTVIQAAGRIVRSPEDHGVTYLADASLLDLFDRARTDMPEW
3436|gene|hwa       RVSRRLSDGKWSWYRRVALQTVIQACGRIVRSPDDHGSTYLADSSLLTLFNNARNEMPAW
1230|gene|hbo       RVAQRLEDGQWSWYRRAALRTVIQACGRVVRAPDDYGATYLADSSLLQLFDRTRSEMPEW
2213|gene|hla       RVARRLADDQWAWYHRTALRTVIQACGRVVRAPDDYGATYLADDSLLDLFDRAKADTPPW
898|gene|nph        RVARRLEDGQWNWYYRTALRTVIQACGRVVRSPDDYGATYLADTSLLDLFERARGAMPSW
12901|gene|hma      RVARRLEDDQWGWYYRTALRTVIQACGRVVRAPDDHGATYLADTSLLDLFERADHDMPDW
170|gene|hhi        RVARRLEDDQWGWYYRTALRTVIQACGRVVRAPDDYGATYLADSSLLDLFERAEHDMPDW
                    **: ** *..* ** * **.*:***.**:**:*:*:* **:** *:* :*:.:    * *

2476|chp|nrc1       FAAQVDAMTTPDLAEPD----------------PAAALGETTAGVEQVEAATRS------
1013|gene|hut       FAEQVDRMERPDLPAAD----------------PDAALAGLTDGRSN-GGSGRS------
3436|gene|hwa       FREQVDRISTPTLPTFE----------------EAINTVGRASTAGVSSPSTST------
1230|gene|hbo       FAEQVRRMSTPDLPEFDQEAAGGRGRSSGSRPSPRSSPSRSSSGSSRSSGSSRS------
2213|gene|hla       FRDQIDAMTTPTLPDFD----------------PTAALAGIDAEPSGPSRAARRGGTALG
898|gene|nph        FAEQVDRMSKPDLPSFD----------------PEAALGDAD------SRSRTR------
12901|gene|hma      FRAQVDRLSQPDLPRFA----------------PDQALSALS------SGTKRR------
170|gene|hhi        FRAQVDRLSAPDLPRFA----------------PDQALSALS------SGTKRR------
                    *  *:  :  * *.                                    :         

2476|chp|nrc1       ------------------------------TDTGGRGSTGETQPDRAASRDDRDSEGSPV
1013|gene|hut       -------------------------------------GSGGSRRSRRSSSS--RSQSNPV
3436|gene|hwa       ---------------------------------AQSDDHSKHANSNNKTNSEDRRSAHPL
1230|gene|hbo       ---------------------SSRQSSGSTSSRGRSGTGGENSRSRSQSDDADDRSNHPL
2213|gene|hla       GGSAGSGLGGSGSLKGGGSHAGDSTASGEAETADGTNDGGGTTRTRSEADAE-RRENHPL
898|gene|nph        -----------------------------------------RSQTGQSTGEN-GMDDHPL
12901|gene|hma      -----------------------------------------HDRSRSRSGD----GNHPL
170|gene|hhi        -----------------------------------------HDRSRSRSGD----GNHPL
                                                                    :         *:

2476|chp|nrc1       ADVWNTE
1013|gene|hut       ADVWDTE
3436|gene|hwa       SDVWGEN
1230|gene|hbo       SDVWGDG
2213|gene|hla       SDIWGDG
898|gene|nph        SDVWGDG
12901|gene|hma      SDVWD--
170|gene|hhi        SDVWD--
                    :*:*.