HOG Organism Gene ID Name Annotation
aHOG1460 hhi 4079 HAH_4079 hypothetical protein
aHOG1460 hbo HBOR33870 Hbor_33870 hypothetical protein
aHOG1460 hut HUTA1667 Huta_1667 conserved hypothetical protein
aHOG1460 nph NP4686 hypothetical protein
aHOG1460 nrc1 VNG6375 vng6375 no entry
aHOG1460 hma Hma_5023 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


65023|hp|hma      ----------MVPYVSETLF---NEPQGRPLALVQFGVSLTFLCMFAC------------
4079|hp|hhi       --------MSSLHIVDTGLFVAMGQLSNRRYKAVRRFARQNDITFVLPERVYEELTVDDS
33870|hp|hbo      --------MSRLHIADTGLFVAMGQPSNSRYQAVRGFARRNDIAFVLPERVYEELTVDEP
6375|hp|nrc1      ----------------------MGQPSNSRYQAVRRFARRNDVAIVLPERVYEELTVDES
1667|chp|hut      MSDSSSLSSATVTLVDTNVFISVGNPGTSKYRRFRRAIRRAGVTLRIPARVADE--IEDG
4686|hp|nph       MDESSPLSPEHVTLVDTNVFISAGNPGTSKHRRFRQVVRRASVTLFVPSRVEEE--IEQG
                                         .:        ..       : :               

65023|hp|hma      ---TASTGGAGDARWILVL--------VVGTALSGTAESLPK--NRRQAAGVLRFAAILA
4079|hp|hhi       DVEAPPVDAAINEEWADVAAPLDFSKPIVSRAMDGVQRYIAS-ADDRPADEVERADAALA
33870|hp|hbo      DVETPPVDAAIDEGWATVAAPLEFSEPVVSRVMDGVQRYIAN-ADDRPADEVERADAALA
6375|hp|nrc1      DVEAPPVDAAIDEGWATVAAPLEFSEPVVSRVMDGVQRYIAN-ADDRPADEVERADAALA
1667|chp|hut      GV-TPALDRAREEGWARIADAPSVTHSEATRARDVARRTIAAKSPGKDEHDVEKADPVFA
4686|hp|nph       GV-RPALERAQDEGWAKTVDAPTVSHSKATTAQDIARRAIASKSTDKDEHDVEKADPVFA
                      ..   * :  *             .  . . .   :.     .    * .  . :*

65023|hp|hma      -----------------------------------FGILVAAPFI-GFRFIIG---G---
4079|hp|hhi       ALAAQHLSAGTVRE-VYIYTTDIAAGEGAETVLTSEGYGDSVTFVNGFRFLEDLLPGDS-
33870|hp|hbo      ALAAQHLSAGTATD-VYIYTTDIAAGEGAETVLASEGYGDSVTFVNGFRFIEDLIGGDS-
6375|hp|nrc1      ALAAQHLSAGTTTE-VYIYTTDIAAGEGAETVLASEGYGDSVTFVNGFRFIEDLVAGDS-
1667|chp|hut      GLAVEYLLDGTTSDDVTVLTADRVAREAIATAMASLDYADQITILAVWDVIDD---GDDD
4686|hp|nph       GLAVEYLLDKKTADTVTVITADRIACEAIETAISSLGYTGQVSIITLWDLIDA---EDDD
                                                      .     .::  : .:         

65023|hp|hma      ----
4079|hp|hhi       ----
33870|hp|hbo      ----
6375|hp|nrc1      ----
1667|chp|hut      LTFS
4686|hp|nph       FTLI