HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0146COG1199KOG1133 KOG1131 KOG1132arCOG00770Rad3-related DNA helicaseshelicase

HOG Organism Gene ID Name Annotation
cHOG0146 nrc1 VNG2441 rad3b helicase
cHOG0146 hmu HMUK0823 Hmuk_0823 DEAD_2 domain protein( EC:3.6.1.- )
cHOG0146 hma RRNAC2719 rad3b helicase
cHOG0146 hwa HQ3720A rad3b DNA repair helicase-like protein
cHOG0146 hla HLAC2627 Hlac_2627 DEAD_2 domain protein
cHOG0146 hbo HBOR01810 Hbor_01810 DNA helicase, Rad3-like( EC:3.6.1.- )
cHOG0146 hut HUTA1416 Huta_1416 DEAD_2 domain protein
cHOG0146 hvo HVO_0039 HVO_0039 helicase
cHOG0146 nph NP1306A rad3b DNA repair helicase-like protein
cHOG0146 hhi 8 rad3b helicase
MUSCLE (3.6) multiple sequence alignment


2441|gene|nrc1      --------MQFFPKPSPYDNQRAAMDAIRDALDGGTNVLFEGACGTGKTLAALAPALSHA
3720|gene|hwa       -MSTTGNHKRFFPYEEPYPNQHSAMSEIAEALDEQRDVLFEGAPGTGKTLSALCPAIAYA
2627|gene|hla       -MSEAP-HLRFFPYEEPYPNQREAMDRVANALDRGQDVLFEGAPGTGKTLSALVPALEHA
1810|gene|hbo       -MAETSGYMRFFPYDRPYPNQGEAMDGIAEALEAERDVLVEGAPGTGKTLSALVPAVEYA
1306|gene|nph       -MSRSDGSRQFFPYDQPYDHQSDAMERIREALVEERDVLFEGACGTGKTLAALVPALEYA
1416|gene|hut       -MASDPDYARFFPYEEPYDHQREAIEGIGDALEDGSDVLLEGATGTGKTLAALTPALEFA
12719|gene|hma      --------MRFFPFEEPYDHQQEAMGTIYDALEEGRDVLFEGACGTGKTLASLVPALEHA
8|gene|hhi          MATTDDGYMRFFPFEEPYDHQQEAMGTIYDALDEGRDVLFEGACGTGKTLASLVPALEHA
                             .***   ** :*  *:  : :**    :**.*** ******::* **: .*

2441|gene|nrc1      QAEDKTVVITTNVHQQMRQFVREAREIHAT--EPIRAVVFKGKGSMCHIDVDYEECQVLR
3720|gene|hwa       RQTDKTVVITTNVHQQMRQFVADARAIVHSGIDTIRAVVFKGKSSMCHIDVGYQECQTLR
2627|gene|hla       REHDRTVVITTNVHQQMRQFVEDARAITRE--TPIRAVVFKGKSSMCHIDVDYQECQTLR
1810|gene|hbo       RQEDKTVVITTNVHQQMRQFVEDARAITRT--EPIRAVVFKGKSSMCHIDVEYQECQTLR
1306|gene|nph       RAAGKTVVITTNVHQQTRQFIEEARAINEQ--TPIRSVVFRGKASMCHIDVGYEECQALR
1416|gene|hut       RRTDKTVVITTNVHQQMRQFVADARQITEQ--EPIRAAVFRGKGSMCHIDVGYEECQALR
12719|gene|hma      RETGKTVVITTNVHQQMRQFVEDARAITDQ--ERLRAVVFRGKGSMCHIDVDYEECQALR
8|gene|hhi          RETGKTVVITTNVHQQMRQFVEDARAITDQ--ERLRAVVFRGKGSMCHIDVDYEECQALR
                    .  ..*********** ***: :** *       :*:.**.**.******* *:***.**

2441|gene|nrc1      DNTHELVDATRDKRQLEERQRALLDEAQDGDTEAADARQAVMDELEAVESELAALQ-DGN
3720|gene|hwa       DTTRSLVDKERERTQLREQATALLDEIREGNDGAASARSAVTDELESVTSEIEDLS-SGN
2627|gene|hla       DTTREMVETESEVRELETRQRELLAESREGDAGAAEARESVMDELDELEADIDEYD-AAN
1810|gene|hbo       DTTRSLVEKEQDKAELSEQADALVDRMRAGEQGAADARTAVTDELDTLEDELEDLR-EGN
1306|gene|nph       DTTRELVETEQDIAELEARESELRDASKAGDGDAAEARGTVLDELDELEASAEALREERN
1416|gene|hut       ETTRDLVDSEAEQAELERRQRELLDASQEGDSEAAEARSAVMDELDAVAEEIETLKEEQA
12719|gene|hma      DTTRDLVEVESDIAELEQREGELLSDGQAGSSEAMEARNAVVEELRDLQDEREEIETERS
8|gene|hhi          DTTRDLVEVESDIAELEQREGELLSDGQAGSSEAMEARNAVVEELRDLQDEREEIETERS
                    :.*..:*:   :  :*  .   *    . *.  * .** :* :**  :  .         

2441|gene|nrc1      VCERYRQNLVG--NTDEFYQWLYDDVRTPEDIYGYAEEAGFCGYELLKDGIEGVDLAVCN
3720|gene|hwa       ICEYYRNNLTEADATEAFFQWLFDDVRTAEEIYAYAEQRQLCGYELLKEGIEGVDLVICN
2627|gene|hla       VCAHYRNNLVE--DTDEFFGWLFEDVRTPEDVYAYADERELCGYELLKEGMEGVDLVVCN
1810|gene|hbo       ICEYYYNNLTE--DTDEFFSWLFDDVRTPEDIYEYADQRKLCGYELLKEGMEEVDLVVCN
1306|gene|nph       VCDRYYKNLTG--ETDEFYQWLYEDVRTPEEIYEYADRQGLCGYELLKDGIEGIDLVICN
1416|gene|hut       TCDHYYRNLTT--DTDEFYAWLYDDVRTPDQVYEYAERQGLCGYELLKEGIDGVDLVICN
12719|gene|hma      TCDHYYRNLTV--DTSEFYSWLFDDVRTPDDVYEYAHQQGLCGYELLKEGMDGVDLVVCN
8|gene|hhi          TCDHYYRNLTV--DTSEFYSWLFDDVRTPDDVYEYAHQQGLCGYELLKEGMDGVDLVVCN
                     *  * .**.    *. *: **::****.:::* **    :*******:*:: :**.:**

2441|gene|nrc1      YHHLLDPGIRAQFFRWLGRDPEDVVVVFDEAHNIEDAARDHAAETLTEQTLDSALDELQD
3720|gene|hwa       YHHLLDPAIREQFFRWLGRDPDDIVTIFDEAHNIESAARDHAGRTLTENTLEEALTEIKD
2627|gene|hla       YHHLLDPNIREQFFRWIDRDPSEIITVFDEAHNVEDAARDHATRTLTENTLDAALDELTE
1810|gene|hbo       YHHLLDPNIREQFFRWLNREPEDVITVFDEAHNIESAARDHASRALTENTLEQALNELED
1306|gene|nph       YHHLLDPMIREQFFRWLGRDPEDVIAVFDEAHNVADAARDHARRTLAERTLDGALDELED
1416|gene|hut       YHHLLDPFIREQFFRWLGRDPEDVIAVFDEAHNVEDAAREHARRTLAEPTLERALDELGE
12719|gene|hma      YHHLLDPTIREQFFHWIGRDPEDIIAVFDEAHNVESAARDHARRTLTENTLDQALDELDN
8|gene|hhi          YHHLLDPTIREQFFHWIGRDPEDIIAVFDEAHNVESAARDHARRTLTENTLDQALEELDS
                    ******* ** ***.*:.*:*.:::.:******: .***:**  :*:* **: ** *: .

2441|gene|nrc1      TSDQRAAAAERVLGAFRDALVETYEDALRPGGDGPADTKSAVESNWVDVPVANDDRRDDL
3720|gene|hwa       CEDSRAEPAANVFEAFLTALQTTYADAFGFGE------REQVTSEWYDLTVANTDRRDDL
2627|gene|hla       SDDSRAEAAENVVRAFRDALVETRDDALGVGK------HESIGENWEDISIANDDRRDDL
1810|gene|hbo       TDDSRADSAENVISAFLDALKETYDEAFGFGE------REQVGEDWYDLPIANNDRRDDL
1306|gene|nph       VSDARADAAANVVGAFKDALVETYESSFGYGD------REAVGEEWEDVPVDSESGRDDL
1416|gene|hut       VDDPRAGPAGNVLETILTALRETYDDALGFGE------RETVEEDWTDLAIDNDDRRDDL
12719|gene|hma      EEDARTDAAANVIETFRDALVEAYEDSFGFGG------REAVDEHWDDITIANDDRKDDL
8|gene|hhi          EEDARTDAAANVIETFRDALVEAYEDSFEFGA------RAAVDEHWDDITIANDDRKDDL
                     .* *: .* .*. ::  **  :  .::  *       .  : . * *:.: . . .***

2441|gene|nrc1      TLAFLQSYTGPGITEDVTDALGLGEYLDGEYEDAYRNGDATTRRECHVLAAAEFVEAYVE
3720|gene|hwa       TLEFLQQYEGRGIDTEIDLARQLAESIDSRYETAYKNGETATRKECQALHAATFLNAWMT
2627|gene|hla       TLAFLRNYEGKGIDTETELAVQLGQALDEEYERRYRDGETTTRTECQILQAARFVSTWME
1810|gene|hbo       TLAFLDRYEGRGISTEVELALQLGKRLDDEYEEAYKDGEATTRQECQTLQAATFIDTWMA
1306|gene|nph       SVAFLEAYTGQGFETDLESALSLGEELDRRYEQEYKDGETTTRKECPTLTAAAFIETWMD
1416|gene|hut       TLSILQNYTGQGVHEDLEEAVALGQALDQQYDEAYKDGETSVRKECPTLQAATFFDGWFE
12719|gene|hma      TLAFLQGYTGPGFHEELDRALELGRDLDARYQKAFKEGELDTRKECQTLQAAGFISDWLD
8|gene|hhi          TLAFLQGYTGPGFHEELDRALELGRDLDARYQKAFKEGELDTRKECQTLQAAGFIADWLD
                    :: :*  * * *.  :   *  *.  :*  *:  :.:*:  .* **  * ** *.  :. 

2441|gene|nrc1      RGGEFGQYPTAAVRRDDRTEAVYGRAERYTCIPREVTTDLFDAVHASVLMSATLRPFDVI
3720|gene|hwa       DSDTVGTHPLISVRRDETTNEVYARAELYTCIPRAVTADLFDEVHASVLMSATLRPFDVA
2627|gene|hla       EGTELGQYPVVSVRRDGATEEVYGRAELYTCIPRRVTEELFDEVAASVLMSATLRPFDVT
1810|gene|hbo       DGGKLGQHPMCSVRRDGGTDEVYGRAELYTCIPREVTETLFEEVHASILMSATLRPFDVT
1306|gene|nph       ASVEPGEYPVVGVRRSET--GIVGRAELYTCLPRRVTEPLFEELHGTVLMSATLRPFDVT
1416|gene|hut       DGEQTGLYPVVSVRREDGDGDLYGRAELYTAIPERVTRTLFDDLYASVLMSATLRPFDVT
12719|gene|hma      ETDETGQYPVVSVRRDDATDDVYGRAELYTCIPEQVTRDLFSDLHAAVLMSATLRPFDVT
8|gene|hhi          ESDETGQYPVVSVRRDESTDDVYGRAELYTCIPEEVTRDLFEDLHAAVLMSATLRPFDVT
                         * :*  .***.     : .*** **.:*  **  **. : .::*********** 

2441|gene|nrc1      GDVLGLDDPVELAFGLQFPEDRRRTFAVDTEPLFSSNREDRATQQAVAGALRDAAAYTPG
3720|gene|hwa       EDVLGLSNPVQMAYELAYPAENRRTLAVKTPALFSSARNDPDTQSIIADTLADAARFTPG
2627|gene|hla       KDVLGLEDVASLAYGMGYPEENRRTFAVDTPPLFASERNDPETQETVASLLRDAIRFTPG
1810|gene|hbo       EDVLGLSDPATMAYGLAYPEENRHTIAVQTPALFSSEREEPATQETLTQVLTDASRFTPG
1306|gene|nph       EDVLGLEEPLTMAYGEQFPDERRRTYAVETPALFASKRDDPQVQETVGNVIAETVAFTPG
1416|gene|hut       EDVLGLKEPETMAYGPQFPEERRRTYTVDVPSLFASRRDDPELQDTVASVVEDAVRLTPG
12719|gene|hma      ENVVGVEDPVTMAYGAQFPEERRRTYAVDGPALFSSERDDPQTQQRIARTLEDIVRFTPG
8|gene|hhi          ENVVGVDDPVTMAYGAQFPEDRRRTYAVDGPALFSSERDDPQTQQRIARTLEDIVRFTPG
                     :*:*:.:   :*:   :* :.*.* :*.  .**:* *::   *. :   : :    ***

2441|gene|nrc1      NCLFFFPSYAEAKRYHDLL---ADCDATRYLDEPGVAADDLREAFVADGDGALFTSLWGT
3720|gene|hwa       NTLFFFPSYAEAERYATQLRQHDAVSKPVMLDESGTETEPLRQSFVGQNGCVLCTSLWGT
2627|gene|hla       NTLAFFPSYAEAERYYERLG--GADLGSLYLDGPGEDEEKLRRRFVESDDATLFTSLWGT
1810|gene|hbo       NTLVFFPSYAEAERYHERLQARMDVTDRLFLDESGTPTEEIRSKFVESQSAILLTSLWGT
1306|gene|nph       NTLAFFPSYAEAERYYHR----YAGEATPYLDEPGVEAESLRQSFIEDDQAVLFTSLWGT
1416|gene|hut       NTLAFFPSYAEAERYHDR----VDVEATKYLDEPGTRAQELRETFTDGDDGVLFTSLWGT
12719|gene|hma      NTLVFCPSYSEAERYHDM----TAVSATRYLDEPGTQARDLREAFTDGDDGVLYTSLWGT
8|gene|hhi          NTLVFCPSYSEAERYHDM----TAVSATRYLDEPGTQARDLREAFTDGDNGVLYTSLWGT
                    * * * ***:**:**               ** .*     :*  *       * ******

2441|gene|nrc1      LAEGVSFDGDDARTVAVVGVPYPHLDARTEAVQDAYAQAFADRDADQGLRSDRQDAGWRY
3720|gene|hwa       LAEGVSFDDNDARTVAVVGVPYPHLSERAEAVQSAYDRAYSGR----------KDAGWRY
2627|gene|hla       LAEGVSFDGDDARTVVVVGVPYPHLSDRMEAVQDAYNRVFADRDRS-------RDPGWAY
1810|gene|hbo       LAEGVSFDGDDARTVVVVGVPYPHLSERMEAIQDAYDRVYSSR----------REAGWRY
1306|gene|nph       LAEGVSFDGDDARSVLVVGVPYPHLDERMEAVQGAYDGAFGDGT---------DDAGWRY
1416|gene|hut       LGEGVSYDGDDARTVLVVGVPYPYLDDRMDAVQDAYDAAFDA-----------EEAGWRY
12719|gene|hma      LGEGVSYDGDDARTVVVVGVPYPHLDDRMDAVQDAYDVAFGDDE---------DDAGWRY
8|gene|hhi          LGEGVSYDGDDARTVVVVGVPYPHLDDRMDAVQDAYDTTFGDGE---------DDAGWRY
                    *.****:*.:***:* *******:*. * :*:*.**  .:              :.** *

2441|gene|nrc1      AVEIPTVRKTRQAMGRVIRSPEDFGVRMLVDRRYTAASRTGMQKYSVNPTFPPSERAEMV
3720|gene|hwa       GIEIPTIRKTRQALGRVIRSPSDYGVRLLIDKRYTQEG-AEMGKYGVRDQFPPEERAELI
2627|gene|hla       AVEIPTIRKTRQAIGRVVRGPDDFGVRILADRRYTS---ADMGKYSVRGAFPPEEREELL
1810|gene|hbo       AVEIPTIRKTRQALGRVIRSPDDFGVRILADKRYTRAS-SEMGKYGVRSTFPPEERAEIV
1306|gene|nph       AVEIPTVRKTRQALGRVVRSPTDFGVRVLVDERYTQSKRADLGEYSVYPEFPPEERNEHI
1416|gene|hut       AVEIPTIRKTRQAMGRVVRSPDDFGARVLVDRRYTEKAEIESPEYAVRGTFPPVERGEMI
12719|gene|hma      AVEIPTIRKTRQALGRVVRSPDDFGARILLDKRYTEAAEMEMHDYAVRGTFPPGERREMV
8|gene|hhi          AVEIPTVRKTRQALGRVVRSPDDFGARILLDKRYTEAAEMEMHDYAVRGTFPPEERREMV
                    .:****:******:***:*.* *:*.*:* * ***        .*.*   *** ** * :

2441|gene|nrc1      DVDPEKLRFSLLNFYGDLGAYGGDPPAP--
3720|gene|hwa       DVEPSKVQFSLLNFYDDLDAYDETAPSPSP
2627|gene|hla       DLDPEKLKFAMLNFYGDHDAYDGAPPEP--
1810|gene|hbo       DVSAEKLKFAMLNFYGDHDAYDGDPPRP--
1306|gene|nph       DIGPEKLKFAMLNFYSDMDAWDGDPPTP--
1416|gene|hut       DVDPDKLKFGLLNFYADMDAYDGDPPAP--
12719|gene|hma      DIGPEKLKFAMLNFYQDMDAYDGPPPNP--
8|gene|hhi          DIGPEKLKFAMLNFYQDMDAYDGPPPKP--
                    *: ..*:.*.:**** * .*:.  .* *