HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0145COG1084KOG1490arCOG00352Predicted GTPaseGTP-binding protein homolog

HOG Organism Gene ID Name Annotation
cHOG0145 nrc1 VNG2595 gbp4 GTP-binding protein homolog
cHOG0145 hmu HMUK0546 Hmuk_0546 GTP-binding protein HSR1-related
cHOG0145 hma RRNAC2374 gbp4 GTP-binding protein
cHOG0145 hwa HQ3140A GTP-binding protein
cHOG0145 hla HLAC2297 Hlac_2297 GTP-binding protein HSR1-related
cHOG0145 hbo HBOR05240 Hbor_05240 predicted GTPase, COG1084
cHOG0145 hut HUTA1159 Huta_1159 GTP-binding protein HSR1-related
cHOG0145 hvo HVO_1925 HVO_1925 gbp GTP-binding protein
cHOG0145 nph NP0584A GTP-binding protein
cHOG0145 hhi 2813 gbp3 GTP-binding protein HSR1-like protein
MUSCLE (3.6) multiple sequence alignment


2595|gene|nrc1      --MIFESLPTTPTSEELIDQAFSRAARAGRAKQGVEAQQSMLQTASNILGDNLHNVVTEW
2297|gene|hla       --MIFEGLPTTPRSEELVDKAFSRAARAGRAKHGHEAQESMLRTAGNVLSDNLENVVVSW
3140|gene|hwa       --MIFESLPTTPRSSELIDKAFSRAARSGRAKSGLKAQQSMLQTASAILSDNLENVVTQW
5240|hp|hbo         --MIFESLPTTPRSEELLDKAFSRAARSGRAKSGHEAQESMLQTASSILSDNLENVVTEW
584|gene|nph        --MHFEDLPTTPRSEELVDKAFSRAARAGRAKQGKEAQESMLQTASNILSDNLENVVTSW
1159|gene|hut       MSHPFETLPTTPTSEELIDQAFSRAARAGRAKSGHDAQQSMLQTAANVLSDNLENVVTQW
12374|gene|hma      MSHPFEGLPTTPTAEELVDKAFSRASRAGGAKDGNEAQQSMLMTASNIASDNMENVVTAW
2813|gene|hhi       MSHPFEGLPTTPTAEELVDKAFSRASRAGGAKDGNEAQQSMLMTASNIASDNMENVVTAW
                        ** ***** :.**:*:*****:*:* ** * .**:*** **. : .**: ***. *

2595|gene|nrc1      PDFD-HVDPFYGELADAILREEFAS--EDGIDELRQHLSELSWASSKTHDLGREYIGRLP
2297|gene|hla       PDFGFDVEPFYYELADAIV----------DVDRLRQALSQVMWASRQIEDLRDEYTTKIR
3140|gene|hwa       PDFE-SVDPFYYELADAIV----------DVDALRQSLSRVTWTSRQIGTLRREYQSKLR
5240|hp|hbo         PDFG-TVDPFYYELADAIV----------DVDELRQSLSEVTWASRQIAEIRSEYLSKMR
584|gene|nph        PDFE-LVDTFYYEFADATLADT----DVGGVDPLRQHLSEVMWAGRQADKIKDEYHGRIR
1159|gene|hut       PDFD-TLDPFYRELADA----------EHGVDELRQHLSEVTWASRKTSDIRDEYQSRLR
12374|gene|hma      PTID-DLDPFYVELADAVVGEAYPADDDPGIDALKQHLSEISWAADKVVEIRQEYESRVA
2813|gene|hhi       PTID-DLDPFYIELADAVIGEAYPADNDPGIDALKQHLAEVSWAADKVVEIRQEYESRVA
                    * :   ::.** *:***            .:* *.* *: : *:. :   :  **  .: 

2595|gene|nrc1      N-DAEKARSLRKQGFGRMGSVMDQVEDDLEAVGAARDALKTLPEIQPDVPTVVVAGYPNV
2297|gene|hla       NSDVDTARKHRKQAFARMADVMDQIEDDLRYIGDSRDQLKVLPDIRPDEPAIVIAGYPNV
3140|gene|hwa       KTESKTARKHRKQAFARMADLVEDIADDLDQIGSARDAVKNLPDIRPDEPAIVVAGYPNV
5240|hp|hbo         KTDKDTARKHRKQAFARMADIMDEIEDDLLQIGEARDSLKGLPDIRPDEPAIVVAGYPNV
584|gene|nph        NSDTDTARKLRKQAFARLADITEQVEDDLLAIGTAREALKTLPDIRADEPAIVVAGYPNV
1159|gene|hut       GVDVDGARKLRKQAFARLADITRQVDENLAALADARQELRKLPDIKPDEPVIVIAGYPNV
12374|gene|hma      RGDIDTARKLRKQAFARIADVVEEVEDDLAAISTAHNALKDIPDIRPNEPAIVVAGYPNV
2813|gene|hhi       RGDIDTARKLRKQAFARIADVVEEVEDNLAAISTAHNALKDIPDIRPDEPAIVVAGYPNV
                      : . **. ***.*.*:..:  :: ::*  :. :.: :. :*:*..: *.:*:******

2595|gene|nrc1      GKSSFVNAVTNASIETAEYPFTTKSVDIGHFERDHITWQLVDTPGLLDRPADERNEIEDQ
2297|gene|hla       GKSSFVNRVTRASNQIAEYPFTTKGVQIGHFERDHVRYQIVDTPGLLDRPEDERNDIERQ
3140|gene|hwa       GKSSFVNAITRADNEIAHYPFTTTGIHVGHFERNRIRYQIVDTPGLLDRPATERNDIERQ
5240|hp|hbo         GKSSFVNHVTRASNEIARYPFTTKGVQIGHFERDRIRYQIIDTPGLLDRPEEDRNDIEKQ
584|gene|nph        GKSSFVNTVTNARNETAAYPFTTTEINVGHVEDNHVRYQLIDTPGLLDRPSEDRNPIESQ
1159|gene|hut       GKSSFVNSVTRADNEIAAYPFTTTQIHVGHIERDHIRYQLVDTPGLLDRPPAERNAIEAQ
12374|gene|hma      GKSSFVNRVTRADNEIASYPFTTTQIRVGHFEDQRIRYQLVDTPGLLDRPPEDRNEIESQ
2813|gene|hhi       GKSSFVNRVTRADNEIASYPFTTTQIRVGHFEDQRIRYQLVDTPGLLDRPPEDRNEIESQ
                    ******* :*.*  : * *****. : :**.* :.: :*::*********  :** ** *

2595|gene|nrc1      AVSALTHVGDVILFFVDASAACGYPVADQQALRAEVGDRFGD--APLVTVCSKTDLSAEI
2297|gene|hla       AVSALEHLADVVVFVLDPSGDCGYPLNVQLELREEVRELFGE-AVPFLTVANKHDRFEAV
3140|gene|hwa       AVSAIEHLADIILFMTDASEACGYPLADQLALRDDVIERFREREIPVLTVNNKSDRSEAI
5240|hp|hbo         AVSALEHLADAALFVVDASGDCGYPLDAQLELRDAVEARFAERNVPVLTVCNKSDRSTDV
584|gene|nph        AVSALTHLADAVLFVLDASGECGYPLDSQRDLLDDIESTF-D--VPVIVVCNKADRSTDT
1159|gene|hut       AVSALEHLADAVLVMVDASGECGFPIDVQLELRDDIASRFGD--APVLTVCNKADRSRDV
12374|gene|hma      AVSALEHLADAVLVFIDPSGECGYPLADQLELRNAIEARF-D--VPVLTIANKSDLSTDV
2813|gene|hhi       AVSALEHLADAVLVFVDPSGECGYPLADQLELRNDIEARF-D--VPVLTIANKSDLSTDV
                    ****: *:.*  :.. *.*  **:*:  *  *   :   * :   *.:.: .* *     

2595|gene|nrc1      EA---DCYMSVEGGEGVTETLTAAVDAVGHEPELPFEE---
2297|gene|hla       QAESVDATMSVTEDENVEDVLDMAVEAAAFEPDLPTRDGEE
3140|gene|hwa       AA---DCQMSIKYDEGIDTVLTTTVDAAGWEPDIPPSRQA-
5240|hp|hbo         EA---DYYMSVENEEGVEEVLTASVDAVAWSPDIPPSRQE-
584|gene|nph        EA---DHYMSVETGENVDEVLDAAIDAVDYELELPFEDDE-
1159|gene|hut       AA---DHYMSVTEDDNVEGVLDAAIDAVGYEPELPFEE---
12374|gene|hma      EA---DHYMSVTEDDNVDGVLQAAIDAVDYELELPFDE---
2813|gene|hhi       EA---DHYMSVTEDDNVDGVLQAAIDAVGYEIELPFDE---
                     *   *  **:   :.:  .*  :::*.  . ::*