HOG Organism Gene ID Name Annotation
aHOG1445 hhi 1149 thiJ putative intracellular protease
aHOG1445 hbo HBOR19390 Hbor_19390 intracellular protease, PfpI family( EC:3.2.- )
aHOG1445 hla HLAC2222 Hlac_2222 intracellular protease, PfpI family
aHOG1445 hmu HMUK2697 Hmuk_2697 intracellular protease, PfpI family( EC:3.2.- )
aHOG1445 hut HUTA0349 Huta_0349 intracellular protease, PfpI family
aHOG1445 hma Hma_10489 pip putative intracellular protease
MUSCLE (3.6) multiple sequence alignment


1149|gene|hhi       -MGKDILMIVGDFGEDYEIMVPFQALQMVGHEVDAVCPDKAAEETIKTAIHDFRGDQTYM
10489|gene|hma      -MGKDILMIAGDFVEDYEIMVPFQALQMVGHEVDAVCPDKAAEETVKTAIHDFRGDQTYM
19390|gene|hbo      -MGKKILMIVGDFGEDYETMVPFQALQMVGHEVDAVCPDKSAGETVKTAIHDFRGDQTYL
2222|gene|hla       MTGQQILMIVGDFGEDYEIMVPFQALQAVGHEVHAVCPEKEDGETVKTAIHDFRGDQTYL
349|gene|hut        MESKQLLMIVGDFGEDYEIMVPFQALQAVGHEVDAVCPEKEGEETIKTAIHDFRGDQTYL
                      .:.:***.*** **** ******** ***** ****:*   **:*************:

1149|gene|hhi       ESRGHDFVLNATMADVTPSDYDALCVPGGRAPEYLRTYDEVLDAVQHFFEEDKPVAALCH
10489|gene|hma      ESRGHDFVLNATMADVNPSDYDALVVPGGRAPEYLRTYDEVLDAVQHFFEEDKPVAALCH
19390|gene|hbo      EERGHDFEVNATFDEIDPAEYDALVVPGGRAPEYLRTYEEVLDTVRHFFDEGKPVAAVCH
2222|gene|hla       ETRGHDFALTHGFDEIDPADYDALVVPGGRAPEYLRGYDEVLDTVRHFFEADKPVASICH
349|gene|hut        EERGHDFELTATMADVDPTEYDGLVVPGGRAPEYLRGYDVVIEAVQHFFEADKPVASICH
                    * ***** :.  : :: *::**.* *********** *: *:::*.***: .****::**

1149|gene|hhi       GPQILAAADVLDGYEMTSYPACRAECEAAGCSWVDEVVTDGNLVTGQAWPDHPEWLAQFM
10489|gene|hma      GPQILAAADVLDGYEMTSYPACRAECEAAGCSWVDEVVTDGNLVTGQAWPDHPEWLAQFM
19390|gene|hbo      GPQILAAAGVLDGYEMTAYPAVRAEVEAAGCSWVDEVTVDKNLVTAQAWPDHPEWLAKFL
2222|gene|hla       GPQILAAAGVLDGYEMTAYPAVRPEVEAAGCSWVDGVTTDGNLVTGQAWPDHPEWIAQFL
349|gene|hut        GPQILAAAGVLDGYEMTAYPAVRPEVEAAGCSWVDGVVRDDNLVTGQAWPDHPEWIATFL
                    ********.********:*** *.* ********* *. * ****.*********:* *:

1149|gene|hhi       TLLGDDVSHGEPIPADD
10489|gene|hma      TLLGDDVSHGEPIPADD
19390|gene|hbo      ELLGTEITETEVATADD
2222|gene|hla       DLLGTEIEHDAPAATAD
349|gene|hut        ELLEEQ-----------
                     **  :