HOG Organism Gene ID Name Annotation
aHOG1442 hhi 2413 HAH_2413 hypothetical protein
aHOG1442 hbo HBOR07830 Hbor_07830 predicted acetyltransferase
aHOG1442 hla HLAC2112 Hlac_2112 hypothetical protein
aHOG1442 hmu HMUK0598 Hmuk_0598 GCN5-related N-acetyltransferase
aHOG1442 hut HUTA0434 Huta_0434 conserved hypothetical protein
aHOG1442 hma Hma_11899 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


434|chp|hut       MREFRPISAAERTAFDRIRQYAFHAEDGPHVTDAGEDGDDHPPIGTRYGYFD--------
2413|hp|hhi       MSEFRPVPTTDREACQRMLQYAFAPETGPVTPDP--DSDWPPSLFDQRGLYD--------
11899|hp|hma      MSEFRPVPTTDREACQRILQYAFAPETGPVPPDP--DGDWPPSLFDQRGLYD--------
7830|hp|hbo       -MFLRQLPADHRDAFRAMVDYAFRPTEGPDWQE---QDRPLPDLFTRFGYYDAPPDEEPD
2112|hp|hla       -MEYRPFPDERSDEFDAFMRYAFSPAEGPYDPE---EADDHDTIADTRGLFDT-------
                      * ..         :  *** .  **   :   :      :    * :*        

434|chp|hut       EEKPASICIHYTFEMRVRGEWTTVGGHGAVATPPERRREGNVRRMLRESLRTF--EVVPL
2413|hp|hhi       GDGLRAVCKLYYLDTTVRGEAATVGGLGAVATPPEHRGQGYAADLCRHALHEYREADVGF
11899|hp|hma      GGTLRAVCKLYFFDTTVRGAATTVGGLGAVATPPEHRGQGLAADLCRHALSAYRKADVGF
7830|hp|hbo       PDDLRTVCGSYDFTVRIRGDWHAAGGVSAVASPPEGRRQGAVSAMLDALLEHYREEGTAF
2112|hp|hla       DDDPVAVCAHHSFSLRIRGADREVAGLSAVASPPEHRRQGNVGRMLRESLTEYRDRGVFV
                       ::*  : :   :**    ..* .***:*** * :* .  :    *  :    . .

434|chp|hut       VTLWPFSTAFYRQFGWATANEITRYTVPPETLA-------GVSEEPGEFRPVEPD-DWRD
2413|hp|hhi       VTLWPFSTPFYRRLGWSTANTYRRFDLPPSALP--------DHDTAGQMVRLDAD-DWER
11899|hp|hma      VTLWPFSTPFYHRLGWGTANTYRRFDLPPSALP--------DPSTAGQLVRLDAD-DWER
7830|hp|hbo       SVLWPFEYEFYRRLGWATCTNYAEASIPPEQLA------DSAPQPAGTFRTLDPDKDLAA
2112|hp|hla       STLWPFEYPFYASYGWATASRYRYLTAPPDQLGFVDDLIATAGDDAGSFRPLDED-DYAA
                   .****.  **   **.*..       **. *           . .* :  :: * *   

434|chp|hut       LRKSHLAAGRGETLSMRRSEQWWRRRIFHEWGEDR-RHAYAYYRDDT-PAGYVVYSVERD
2413|hp|hhi       LRQVESASAAGTALSLRRSEAWWRERTLADWDDDGVPYCYGYERNGD-LRGYVVYTVADD
11899|hp|hma      LRRVETAAAAGTALSLRRSEAWWRERTLADWDDDGVPYCYGYERDGE-LQGYVVYTVADD
7830|hp|hbo       IRKVHETWAT-EALAVRRTDGWWRERTFRGWETD--PYVYGWFDDEETLRGYLIYTISEG
2112|hp|hla       VKPVIAAMADRYDLTMDWTEEWWRERALQGWKTD--PFVYGWERDGD-LRGICAYSFDDD
                  :.    : .    *:: .:: *** * :  *  *   . *.:  :     *   *:.  .

434|chp|hut       DAAE----LDVKYHGARDHAAYRAVLGFLGDHDSQVDSVSFARPGD-SVLFDTLGDPQAA
2413|hp|hhi       ADRT----LSATQFAAADEEARRALFAFLGHHGAQIDRVTLQLPPD-TDLFHRVDDPGAV
11899|hp|hma      ANNT----LSVSNFAAVDEEARRALFAFLGHHGAQIERVTLQLPPD-TDLFHRVDDPGAV
7830|hp|hbo       DDGRD---MRVWERAFTDHEARAHLLRFCRDHDSQVETVTFTTLSEWSRPIEGLPDPRAA
2112|hp|hla       ADDADETVMRVTDVAAADDEAWFQLLRFVRNHDSQVAEVRIQAPPD-APLLDLVEDPRAV
                          : .   .  *  *   :: *   *.:*:  * :    : :  :  : ** *.

434|chp|hut       DVELLPGPMVRLTDVPAALEAIPYPDGLDERVTLSVDDPLLPENDGTYELLVEGGDGSCR
2413|hp|hhi       DCTVEAGPMVRLTDVDY-LERLDW-PGGDLDCTLSVNDPLLDRNDGLFRLSVNGGTATVD
11899|hp|hma      DCTVEAGPMVRLTDVDY-LERLDW-PGGDLDCTLSVNDPLLDHNDGLFRLSVNGGTATVD
7830|hp|hbo       TLEIKTGPMARIVDVEAALTALSY--DVQESVVLAVSDERCAWNDDTFELRVDAAGARVN
2112|hp|hla       DCEIRTGPMVRLVDAATALEALDPDPEIETAFSLSVSDPLVDWNDETFRVAVADGTVAVE
                     : .***.*:.*.   *  :      :    *:*.*     **  : : *  .     

434|chp|hut       SVTAD-----------APDVTVGVGPLSRLVIGARSADTLATVGDLT-ADPATRETLAEL
2413|hp|hhi       PLPASD---------SKADVAVNIATLSQLAVGTHGVDAAERLAGLEMFDDSVRGPLADV
11899|hp|hma      PLPASD---------SKADVAVDIATLSQLAVGTHGVDAAERLAGLEMFDDSVRGPLADV
7830|hp|hbo       RVET------------TPDAELDVGALSQLAVGAREAAELERTGDLTVSDATVRETLADL
2112|hp|hla       PTVDGEVDKSEVDGAEAADAAIDIGTLSQLYVGYTSVDEAVRSDGLA-VGSALADDLRAV
                                   .*. :.:..**.* :*   .       .*   . :    *  :

434|chp|hut       FPSERVFLREFF
2413|hp|hhi       FQPESVYLGEFF
11899|hp|hma      FQPESVYLGEFF
7830|hp|hbo       FPDERTYLREGF
2112|hp|hla       FPPRTTHLREGF
                  *    ..* * *