HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0144COG0012KOG1491arCOG00357Predicted GTPase probable translation factorGTP-binding protein homolog

HOG Organism Gene ID Name Annotation
cHOG0144 nrc1 VNG0504 gbp5 GTP-binding protein homolog
cHOG0144 hmu HMUK2814 Hmuk_2814 GTP-binding conserved hypothetical protein TIGR00650
cHOG0144 hma RRNAC0269 gbp1 translation-associated GTPase
cHOG0144 hwa HQ2628A gbp translation-associated GTPase
cHOG0144 hla HLAC0779 Hlac_779 GTPase of unknown function domain protein
cHOG0144 hbo HBOR16130 Hbor_16130 GTP-binding conserved hypothetical protein TIGR00650
cHOG0144 hut HUTA2275 Huta_2275 GTP-binding conserved hypothetical protein TIGR00650
cHOG0144 hvo HVO_1608 HVO_1608 gbp GTP-binding protein homolog
cHOG0144 nph NP1668A gbp5 translation-associated GTPase
cHOG0144 hhi 1013 ychF translation-associated GTPase
MUSCLE (3.6) multiple sequence alignment


504|gene|nrc1       MLSIALAGKPNAGKSTFYTAATRSEVDVANYPFTTIDANRGVTHVRTACPCLTREERCGH
1668|gene|nph       MLSVALAGKPNAGKSTFYTAATMADADTGNYPFTTIDPNRGVTHVRTRCPCLDLESRCGN
779|gene|hla        MITVALAGKPNAGKSTFYTAATMADVDVANYPFTTIDANRGVTHVRTECPCLDRDERCGN
10269|gene|hma      MLSIALAGKPNAGKSTFYKAATMADVDVGNYPFTTIDANRGVSHVRTDCPCLDREERCGD
1013|gene|hhi       MLSIALAGKPNAGKSTFYKAATMADVDVGNYPFTTIDANRGVSHVRTDCPCLDREERCGD
2275|gene|hut       MLSLALAGKPNAGKSTFYTAATMADVDVANYPFTTIDANRGVSHARTQCPCLDLDERCGN
2628|gene|hwa       MLSIALAGKPNAGKSTFYQAATMADVDVGNYPFTTIDPNQGVTHARTRCPCLDTETRCGN
16130|gene|hbo      MLSIALAGKPNAGKSTFYKAATMADVDVGNYPFTTIDPNRGVSYARTRCPCLDRDERCGN
                    *:::************** *** ::.*..********.*.**::.** ****  : *** 

504|gene|nrc1       EHCHDGKRYVPVELLDVAGLVPGAHEGRGLGNQFLDELSNADVIVNVVDASGATNEEGEP
1668|gene|nph       DTCHGGKRYVPVELLDVAGLVPGAHEGKGLGNQFLDELTNADVILHVVDASGGTDAEGEP
779|gene|hla        ENCRDGKRYVPVELLDVAGLVPGAHEGKGLGNQFLDELTNADVVLNVVDASGATNAEGEP
10269|gene|hma      DNCRDGKRYVPVELIDVAGLVPGAHEGRGLGNQFLDELSTADVILNVVDASGGTDAEGEP
1013|gene|hhi       DNCRDGKRYVPVELIDVAGLVPGAHEGRGLGNQFLDELSTADVILNVVDASGGTDAEGEP
2275|gene|hut       DRCHDGKRYVPVKLLDVAGLVPGAHEGRGLGNQFLDELTDADAILHVVDASGATDEEGEP
2628|gene|hwa       --CTDGIRYVPVELLDVAGLVPGAHEGRGLGNQFLDALTDADAILAVVDAAGATNAQGDP
16130|gene|hbo      --CEDGVRYVGVELLDVAGLVPGAHEGRGLGNQFLDALTNADVILAVVDASGGTNEEGEP
                      * .* *** *:*:************.******** *: **.:: ****:*.*: :*:*

504|gene|nrc1       VEIGDHDPVEDIDFVEEEMDLWLAGIVEDNWESVERASRSPGFDIETAITEMMTGFGASE
1668|gene|nph       VEAGSYDPLEDVEFIETEMDLWLADIVERNWETIERQARSPEFDFEAALTELLTGVGASE
779|gene|hla        VEVGAHDPLDDVDFIEEEMDLWLAGIVDRNWEGVERQSRSPDFDLEAAVTDLLTGFGATE
10269|gene|hma      VEVGEHDPVEDVHFVEEEMDLWLASIVERNWESIERQSRSPDFKLDESLVDMLAGVGASE
1013|gene|hhi       VEVGEHDPVEDVHFVEEEMDLWLASIVERNWESIERQSRSPDFKLDESLVDMLAGVGASE
2275|gene|hut       VEIGEHDPVEDLDFIEEEMDLWLASIIERNWETVERRSRSPDFDIDEALSEFLTGVGATE
2628|gene|hwa       VEVGTYDPVEEANFVEEELEQWLAGIIDRNWETVVRQSRAPDFKIDEAVTELLTGFGASE
16130|gene|hbo      VEVGTYDPVEEADFVEAELEQWLAGIIDRNWESVVRKSRSPDFDIDDALTEMLTGFGATE
                    ** * :**:::  *:* *:: ***.*:: *** : * :*:* *.:: :: ::::*.**:*

504|gene|nrc1       YQVAAVLREFDYPDDPIQWSGEDREALARGVRERTKPIVVVANKVDVAPEENVQRLLD-L
1668|gene|nph       YDVMAVLRELEYETDPGAWSDADREELARLLRERTKPIVVVANKADIAPEENIERLRE-A
779|gene|hla        HDVTAVLRELEYPDDPKAWTDADREALARAIRRRTKPIVVVANKVDAAPEGAVDRLREGT
10269|gene|hma      LDVARTLRDLEYPEDPIAWTDEHREALATEIRQRTKPLVVVANKADIAPEGNIEALQE-A
1013|gene|hhi       LDVARTLRDLEYPEDPIAWTDEHREALATEIRQRTKPLVVVANKADIAPEGNIEALQE-A
2275|gene|hut       LDVARTLRELEYPEDPLAWTDEHRESLASDIRARTKPIIVIANKADVAPPENIQALKE-R
2628|gene|hwa       HDVATALRSISYPDDPQQWSMDDQMALAVDIRERTKPIVLVANKADIAPVENINRLHD-T
16130|gene|hbo      YDVAASLRSLDYPEDPQQWTDEHQEALASDVRARTKPIVLVANKADVAPPENLERLRE-V
                     :*   **.:.*  **  *:   .  **  :* ****::::***.* **   :: * :  

504|gene|nrc1       DKPVIPATAQGELAVRRGADAGFLDYDPGDEDFDITGDVGDDQREALEALRETMQEYGGT
1668|gene|nph       AERVIPCTAEGELALRRGVEAGVVDYDPGDEAFEIAAEVSEAQRQGLESVRSVIDQWGGT
779|gene|hla        DKPVVPVTADGELALRRAAEAGVVDYDPGDEGFDVVGDISDGQREGLEAIRGAMAEYGGT
10269|gene|hma      ADVVVPATADGELALRNAAQAGVIDYDPGDPDFDIVGDVSDQQREGLNRIRGVMDDWGGT
1013|gene|hhi       ADVVVPATADGELALRNAAQAGVIDYDPGDPDFDIVGDVSDQQREGLNRIRGVMDDWGGT
2275|gene|hut       NEATIPVTADGELALRRAVEADIVEYDPGDPDFEITGDISDDQEAGLERIRDVMDDHGGT
2628|gene|hwa       SKPVVPATADGERALRRAADADLIEYNPGDTAITITGDISSTQQTGLETIQNVMENTDGT
16130|gene|hbo      DKPVVAATADGELALRRAADAGIIDYLPGDDDFDIVGDVSDAQQSGLEKIREVVETNGGT
                     . .:. **:** *:*...:*..::* ***  : :..::.. *  .*: :. .:   .**

504|gene|nrc1       GMQRALDYAVYDLLEMVTAFPVQDQSKWTDATGTVLPDAVLLDAGSTPVDLAYAVHSDIG
1668|gene|nph       GVQEALDEAVYGLLDQITVYPVQNETRWTDGQGDVLPDAFLLPSGATPKDLAFAVHSDIG
779|gene|hla        GVQTALNAAVYDLLDRITVFPVQDASKWTDGTGNVLPDAFLLPAGATPPDLAYAVHTDIG
10269|gene|hma      GVQGALDTAVYDLLDHLTAYPVQNETHWTDGQENVLPDAFLLRQGATPKDLAYAVHSDIG
1013|gene|hhi       GVQGALDTAVYDLLDHLTAYPVQNETHWTDGQENVLPDAFLLRQGATPKDLAYAVHSDIG
2275|gene|hut       GVQKALDTAVYEVLDQLTAYPVQDETHWTDGQGNVLPDAHLLPDGSTPRDLAYAVHSDIG
2628|gene|hwa       GVQAAINTAVYHLLEMITVYPVENETRWTDGSDDMLPDAVLLRKGSTPLDLAYAVHSDIG
16130|gene|hbo      GVQEAINTAVYDVLDMVTAYPVQNETRWTDGTGEMLPDAFLLERGSTPKDLAYAVHSDIG
                    *:* *:: *** :*: :*.:**:: :.***.   :**** **  *:** ***:***:***

504|gene|nrc1       DGYLHAVNAKTNREIGEDDELGEGDVVKIVSTAN-
1668|gene|nph       EGYLHAVDAREERRIGEGHELAEGDVIKIVSTAS-
779|gene|hla        EGYLHAVDARSSRRIGESHELSEGDVVKIVSTAGP
10269|gene|hma      DGYIHAVDARENRRISDETELEEGAVIKIVSDAN-
1013|gene|hhi       DGYIHAVDARENRRISDETELEEGAVIKIVSDAN-
2275|gene|hut       EGYLHAVDAREKRRISDDTELDEGDVIKIVSTAK-
2628|gene|hwa       DGYLYAVDARAERRISEDHELSEGAVVKIVSTA--
16130|gene|hbo      EGYLHAVNARSDRRIAEDYELDEGDVIKIVSTAN-
                    :**::**:*. .* *.:  ** ** *:**** *