HOG Organism Gene ID Name Annotation
aHOG1428 hhi 321 HAH_0321 hypothetical protein
aHOG1428 hbo HBOR01590 Hbor_01590 hypothetical protein
aHOG1428 hla HLAC1451 Hlac_1451 hypothetical protein
aHOG1428 hmu HMUK1098 Hmuk_1098 conserved hypothetical protein
aHOG1428 hut HUTA2619 Huta_2619 conserved hypothetical protein
aHOG1428 hma Hma_13066 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


1451|hp|hla       MSKDVGADPDDEPITPGETVYDEDGQVLGQVSGYTTDGFEVKIGEGGSASGDDAETIPGQ
1590|hp|hbo       -MSG-----EKSIASIGTTVYTEDGDELGTVRGFDEDGFFVTTREGIASLSIEHER-AGH
2619|chp|hut      -MAS-----EPTEVTFGTGVYDEAGNKLGTVRGFDEHGFYVSTDDGIAALSSEHLA-SGI
321|hp|hhi        -MADMTTNIESEEYSFGQTVYDEDGDALGTIRGFDEHGFYVTVEDGIESLSSEHLS-AGA
13066|hp|hma      -MADMTTNIESEEYSFGQTVYDEDGDALGTIRGFDEHGFYVTVEDGIESMSSEHLS-AGA
                     .     :    : *  ** * *: ** : *:   ** *.  :*  : . :    .* 

1451|hp|hla       EFGEGYLMWRCSECGEMGDLGSGMPDTCPECGAPEESIYAVEED
1590|hp|hbo       EFGEAELMWRCANCGEMDTLDE-LPDSCPGCNAPKEELYYWTED
2619|chp|hut      A-GEAELMWRCWSCGEMGQIEQ-LPEECPSCGAPKEDIYYWEED
321|hp|hhi        A-GEAELMWRCWECGEMGQIED-IPDECPSCNAPKEDIYYWQED
13066|hp|hma      A-GEAELMWRCWECGEMGKIED-IPDECPSCNAPKEDIYYWQED
                    **. ***** .****. : . :*: ** *.**:*.:*   **