HOG Organism Gene ID Name Annotation
aHOG1412 hhi 1609 ssuE2 NADPH-dependent FMN reductase
aHOG1412 hhi 59 ssuE1 NADPH-dependent FMN reductase
aHOG1412 hbo HBOR00520 Hbor_00520 predicted flavoprotein( EC:1.5.1.29 )
aHOG1412 hbo HBOR14060 Hbor_14060 predicted flavoprotein( EC:1.5.1.29 )
aHOG1412 hla HLAC1275 Hlac_1275 NADPH-dependent FMN reductase
aHOG1412 hla HLAC2656 Hlac_2656 NADPH-dependent FMN reductase
aHOG1412 hmu HMUK1148 Hmuk_1148 NADPH-dependent FMN reductase( EC:1.5.1.29 )
aHOG1412 hmu HMUK2199 Hmuk_2199 NADPH-dependent FMN reductase( EC:1.5.1.29 )
aHOG1412 hut HUTA2933 Huta_2933 NADPH-dependent FMN reductase
aHOG1412 nrc1 VNG1618 vng1618 no entry
aHOG1412 hma Hma_10982 ssuE1 NADPH-dependent FMN reductase
aHOG1412 hma Hma_12773 ssuE2 NADPH-dependent FMN reductase
MUSCLE (3.6) multiple sequence alignment


520|hp|hbo          ---MTRIVAICGSRREGSYTRKSLEIVLDAA---RDAGAETTMVDLGDVDLPLFHPDKDE
2656|gene|hla       ---MTRIVAVSGSRSADSTTRAALSVALDAA---ADAGAETGMIDLGTVDLPLYHPAEDV
59|gene|hhi         MHDTPHVIGISGSLRDDSGTRIAVQRALDAA---VGDGATIEHIDLREWDLPLFDPDAGE
12773|gene|hma      MPDTPHVIGVSGSLRDESGTRIAVQHALDAA---AGAGATVAHIDLREWDLPLFDPDASA
1618|hp|nrc1        MTVDTHVVAICGSLSDDSGTRTALRTVFDGATAVTDTEVTTDLIDLRELSLPPRDGDDRD
2933|gene|hut       -MSETRVVAICGSLRDNSHTRKSLRIALEAA---ENAGASTELLDLREWELPVFDADRGD
14060|hp|hbo        -MTEKHVVAVCGSLRDQSYTRRALEHALVGV---REAGGTGEILDLRAYDLPSLDADEDE
1275|gene|hla       MSDSAHVVGVVGSLRDGSYTRLGVGRALDGV---RRAGGTAELLDLREYDLPTYDADHDE
1609|gene|hhi       -MSEPHIVGVVGSLREESYTRVGIERALVAA---EELGATTELLDLQEFDLPVFDADHRE
10982|gene|hma      -MSEPRVVGVVGSLREQSYTRVGIERALAAA---EETGATTELLDLQEFDLPVFDADHRE
                         .::.: **    * ** .:  .: ..            :**   .**        

520|hp|hbo          Q--GESERLTRLVRKADGVIIGSPVYHGSYSSTFRNFHDYCSKDEYEDTAVGLVATAGGG
2656|gene|hla       Q--GDSERLTRLVREADGVLAGTPVYHGSYSSTFKNFHDFCGSDEYENTAVGLLATAGGG
59|gene|hhi         ADSGDGPELAARVREADALVLGTPVYHGTIASPLKTALDYCSIDDVEGATVGILAVAGGG
12773|gene|hma      ADSGDGPELAARVREADAMVLGTPVYHGTIASPLKTALDYCSIEDVEGTTVGILAVAGGG
1618|hp|nrc1        A--GDAPALRARVADADALVLGTPMYHGSYSAPLKNALDYCGRDELGGTTVGLVCVAGGG
2933|gene|hut       A--GDAEAFRERVRAADSVILGTPVYHGSFSAPLKNALDYCGFDEFEDTTIGLLAVAGGR
14060|hp|hbo        Q--GDSEVVVERIHEADAVILGTPVYHGSYSGVLKNTLDYCGFDEFDGKTVGLLAVAGGG
1275|gene|hla       A--GDANAFKTRIREADAVPLGTPMYHGSYSSTLKTALDYCGFEEFEDKTVGLLAVAGGG
1609|gene|hhi       V--GDAVEFADRVHAADSILLGTPVYHGSYSGMLKNALDYCGFDEFEHKTVGLLAVAGGG
10982|gene|hma      A--GDAVAFADSIHAADSVLLGTPVYHGSYSGVLKNALDYCGFDEFEHKTVGLLAVAGGG
                       *:.  .   :  **.:  *:*:***: :. :..  *:*. ::    ::*::..*** 

520|hp|hbo          SYGGALEHMRSTIRGVHGHVVPEQVGVRGAYNVYEGDE---LTDEDVRRRLVSLAESVVA
2656|gene|hla       SYGGTLEHLRSTFRNVHAWTVPHEVGIQGASRYVETGEEPRITDDDLRRRTETLGRVVTE
59|gene|hhi         FPTPTLQHLRASVLELKGWPLPQAVAIPESWAAFEDGH---IADEDIAARVEELGSNVVA
12773|gene|hma      FPTPTLQHLRASVLELKGWPLPQDVAIPDSWAAFEDGT---IADGDIIERVEELGASVVA
1618|hp|nrc1        FPRQALSHLRGVCDALDAWTLPHQVGVPNAATTIGDGE---ITDDDIAARARTLGEQAVA
2933|gene|hut       FPITALEQLRTVSRALDAWVIPHQVAIPRASSAYEDGK---LVDDELREMIEVLGAEAVQ
14060|hp|hbo        FPVTALDHLRSVCRALNAWVLPHQVALPNVSSQFDGDE---LVDGGLEKRVHVLGRRVVE
1275|gene|hla       FPVTALEHLRSVCRALNAWVIPHQVAVPRAHAQFDDGD---LVDEDLDGRVLTLGRRAVQ
1609|gene|hhi       FPITALEHLRSVCRALNCWVIPHQAAVPNAHNHIADGQ---IVDADIEERVTSLGEEAVK
10982|gene|hma      FPITALEHLRSVCRALNCWVIPHQAAVPNARNHIADGQ---IVDADIEERVVTLGEEAVQ
                        :*.::*     :  . :*  ..:         .    :.*  :      *.  .. 

520|hp|hbo          EARRLHPEAAQTARADD------------
2656|gene|hla       HAERLRG----------------------
59|gene|hhi         YT-GVADRREETEQSELATGD--------
12773|gene|hma      CA-GIADQREEAEQSELATGD--------
1618|hp|nrc1        YA-NVESFPELTAAGASPSQ---------
2933|gene|hut       YA-HIEPDPASFESGENVGADD-------
14060|hp|hbo        YA-RIEPDPTTFEAGENVGAGENVGAGGK
1275|gene|hla       YA-DIEPDPDSFEGEQNVGAR--------
1609|gene|hhi       YA-NIEPDSACFESTENVGADD-------
10982|gene|hma      YA-NIEPDPACFESAENVGADD-------
                     :  :