HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0141COG0190KOG0089arCOG04538510-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolasemethylenetetrahydrofolate dehydrogenase

HOG Organism Gene ID Name Annotation
cHOG0141 nrc1 VNG1416 folD methylenetetrahydrofolate dehydrogenase
cHOG0141 hmu HMUK2214 Hmuk_2214 Methenyltetrahydrofolate cyclohydrolase( EC:3.5.4.9,EC:1.5.1.5 )
cHOG0141 hma RRNAC0996 folD1 methylenetetrahydrofolate dehydrogenase
cHOG0141 hma PNG7328b folD2 methylenetetrahydrofolate dehydrogenase
cHOG0141 hwa HQ2790A folD methylenetetrahydrofolate dehydrogenase; methenyltetrahydrofolate cyclohydrolase
cHOG0141 hla HLAC1624 Hlac_1624 tetrahydrofolate dehydrogenase/cyclohydrolase
cHOG0141 hbo HBOR13760 Hbor_13760 methenyltetrahydrofolate cyclohydrolase /5,10- methylenetetrahydrofolate dehydrogenase (NADP+) (EC 1.5.1.5)( EC:1.5.1.5,EC:3.5.4.9 )
cHOG0141 hut HUTA2943 Huta_2943 Methenyltetrahydrofolate cyclohydrolase
cHOG0141 hvo HVO_2865 HVO_2865 FolD bifunctional protein.
cHOG0141 nph NP2054A folD methylenetetrahydrofolate dehydrogenase; methenyltetrahydrofolate cyclohydrolase
cHOG0141 hhi 1623 folD1 methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase
cHOG0141 hhi 5225 folD2 methylenetetrahydrofolate dehydrogenase
MUSCLE (3.6) multiple sequence alignment


1416|gene|nrc1      ----------------MTEIIDGDAVAAQLRADLTGAVETLETAGVTPRLATVLMNDKQA
2790|gene|hwa       MRFKYVASKYSCVTQTQTQLIDGTEVAASIRSDLISSVTRIVNTGTTPQLATVLMNDDPA
7328|gene|hma       ----------------MTTVIDGNEIGDQITEGVAACTDTLVSEGVTPGLATVLMSDDGA
5225|gene|hhi       ----------------MTTIIDGNEIGDQITAGVAACTDTLVGEAVTPGLATVLMSDDGA
2054|gene|nph       ----------------MTEVIDGNAVASDIRDDLTDAIATLADAGARPGLATVLMGDDPA
1624|gene|hla       ------MTETSDGDADGTRIIDGEAVAADVRDDVAAHVETLEEEGVTPGLATVLMSDDPA
13760|gene|hbo      ----------------MTDIIDGNAVAAEIRAGLADGIDTLADAGVTPCLATVLMSNDPA
2943|gene|hut       ----------------MADVIDGNAVAQSIRDDLGDAIDTLEDERVTPTLATVLMSDDPA
10996|gene|hma      ----------------MTEIIDGNAVAQSIRDDLVASIDRLADAGHRPSLATVLMSEDPA
1623|gene|hhi       ----------------MTEIIDGDAVAQSIRDDLVASIDHLADAGERPSLATVLMSEDPA
                                     : :***  :. .:  .:      :      * ******.:. *

1416|gene|nrc1      SETYVSMKQQDCEEVGIAAEDVRIDPEASADTLFDTVAELNAREDVHGILVQDPTPDHVP
2790|gene|hwa       SQTYVSMKHDDCEEVGIATRDITIDPEAPAAELFDTVDELNADSSVHGILVQMPLPDHVD
7328|gene|hma       SETYVSMKQRACNEIGIEGFHHQISADESAEALFSTIDELNADPAVHGILVQMPVPDHVP
5225|gene|hhi       SETYVSMKQQACEEIGIEGFHYEISADEPAETLFSTIDELNADPAVHGILVQMPVPDHVP
2054|gene|nph       SETYVNMKQRDCEEVGIESYHVDVDGDAPPETLYDEIAALNQNDDVHGYIVQAPVPDHVD
1624|gene|hla       SETYVSMKQRDCEEVGIESVHVEIDADAPAEELYETIDDLNEREDVHGILVQLPVPDHVD
13760|gene|hbo      SETYVSMKHSDCEEVGIEARDFEIDPEAPAEELYDTIDELNADPSVHGILVQMPVPDHVD
2943|gene|hut       SETYVSMKQDDCAEVGIEAIDVEIDPDAPADELFDEIDRLNADENVNGILVQMPVPDHVD
10996|gene|hma      SETYVSMKQDDCEEVGIEAIDIDIDSDADAAELYDTIEDLNADEDVNGILVQMPVPDHVE
1623|gene|hhi       SETYVSMKQNDCEEVGIEAIDIDIDPDADAAELYDTIEDLNADDDVNGILVQMPVPDHVE
                    *:***.**:  * *:**      :. :  .  *:. :  **    *:* :** * **** 

1416|gene|nrc1      DERVLSAVDPAKDVDGFHPENVGKLVGGTPRFKPCTPHGVQKLLAHQGVDPDGAEVVVVG
2790|gene|hwa       EREVLRRIDPKKDVDGFHPENVGRLVAGQPRYKPCTPHGIQKLLIAADIETEGANAVVIG
7328|gene|hma       KRDVLERIDPMKDVDGFHPENVGRLVAGNARYKPCTPHGIQKMLAETGVVTEGKDVVVVG
5225|gene|hhi       KRDVLERIDPMKDVDGFHPENVGRLVAGNARYKPCTPHGIQKILAETGVETEGKDAVVVG
2054|gene|nph       YREVIRRVDPQKDVDGFHPENVGRLVAGDARFRPCTPHGVQKLLEAADIDTEGKDVTIVG
1624|gene|hla       KRRVLRQIAPVKDVDGFHPENVGRLVAGDARFKPCTPHGVQKLLAAYDVETEGADAVVVG
13760|gene|hbo      EREVLRRIDPAKDVDGFHPENVGRLVAGHPRFKPCTPHGIQKLLAATDVETEGADVAVVG
2943|gene|hut       KQAVLRRIDPEKDVDGFHPENVGRLVAGDARYKPCTPHGIQLLLDDAGVDPEGKDAVIVG
10996|gene|hma      DRSVLRAIDPMKDVDGFHPENVGRLVAGDARYKPCTPHGIQKLIESAGVDTEGKDAVVVG
1623|gene|hhi       DRSVLRAIDPMKDVDGFHPENVGRLVAGDARYKPCTPHGIQKLIESVGVDTEGKDAVVVG
                       *:  : * ************.**.* .*:.******:* ::   .: .:* :..::*

1416|gene|nrc1      RSNIVGKPLANLLAQKAAGGNATVTICHSHTDDLAAHTRRADVVVAACGVPELIDGDMLS
2790|gene|hwa       RSNIVGKPMANLLIQKADAGNATVTTCHSRTNNLASKTRDADIIIAAAGVPEMIDGDMIS
7328|gene|hma       RSDIVGKPMANLLIQYGPGGNATTTVCHSRTDDLADKTRNADIVIAAAGVPEMIDGSMLS
5225|gene|hhi       RSDIVGKPMANLLIQYGPGGNATTTVCHSRTDDLAEKTRNADIVIAAAGVPEMIDGSMLS
2054|gene|nph       RSDIVGKPLANLLIQKADDGNATVTVCHSRTENLAAKTRRADIVVAAAGAPELVDGSMIG
1624|gene|hla       RSDIVGKPMANLLIQKGPIGNATTTVCHSRTRDLEGKLATADIVIAAVGVPEFIDGSMLK
13760|gene|hbo      RSNIVGKPMANLLIQKSELGNATVTVCHSRTENLADKTRAADIVVAAVGIPEFITGEMLS
2943|gene|hut       RSDIVGKPMANLLLQKADGGNATVTVCHSRTDDLAAKTRAADIVVAAAGVPEMIDGDMLS
10996|gene|hma      RSDIVGKPMANLLIQKAPGGNATTTVCHSRTENLAERTRNADILVAAAGVPEMIDGKMIQ
1623|gene|hhi       RSDIVGKPMANLLIQKAPGGNATTTVCHSRTENLAERTRNADILVAAAGVPEMIDGEMIG
                    **:*****:**** * .  ****.* ***.* :*  .   **:::** * **:: *.*: 

1416|gene|nrc1      GDPVVIDVGINRVDADTEKGYELVGDVDYDSAEAAASAITPVPGGVGPMTRAMLLYNTLA
2790|gene|hwa       TGTVVIDVGINRV--ETENGSELVGDVEFESAAKKADAITPVPGGVGPMTRAMLLWNTVK
7328|gene|hma       AGTTVIDVGINRVDADTEKGYELVGDVDFESAKEKADAITPVPGGVGPLTIAMLLYNTVK
5225|gene|hhi       AGTTVIDVGINRVDADTEKGYELVGDVDFESAKAKADAITPVPGGVGPLTIAMLMYNTVK
2054|gene|nph       EGSVVIDVGVNRVDADNEKGYELVGDVEYESATQNASAITPVPGGVGPMTRAMLLYNTVK
1624|gene|hla       EGATVIDVGINRVDADTEKGYALVGDVEYESAKEAAGAITPVPGGVGPMTRAMLLYNTVK
13760|gene|hbo      EGVTVIDVGINRVDADTEKGYELVGDVEYESAKAKAGAITPVPGGVGPMTRAMLLWNTVK
2943|gene|hut       EGVTVIDVGINRVDADTEKGYELVGDVDFDSATEKATAITPVPGGVGPMTRAMLLYNTVK
10996|gene|hma      EGATVIDVGINRVDADTEKGYELVGDVEYESAKEVAGAITPVPGGVGPMTRAMLLYNTVK
1623|gene|hhi       EGATVIDVGINRVDADTEKGYELVGDVEYESAKEVAGAITPVPGGVGPMTRAMLLYNTVK
                     . .*****:***  :.*:*  *****:::**   * ***********:* ***::**: 

1416|gene|nrc1      AASEQTGVAVALP
2790|gene|hwa       ATAIATDTSIELP
7328|gene|hma       AASLQSGVDIRLP
5225|gene|hhi       AASLQSGVDISLP
2054|gene|nph       AASLQEDIDVALP
1624|gene|hla       AAGLQSDVALDLD
13760|gene|hbo      AAGDAEAVDVNLP
2943|gene|hut       AAGLQHGVDVPLP
10996|gene|hma      ATGLQHDIDVDLP
1623|gene|hhi       ATGLQHDIDVDLP
                    *:.      : *