HOG Organism Gene ID Name Annotation
aHOG1409 hhi 1326 HAH_1326 hypothetical protein
aHOG1409 hbo HBOR19600 Hbor_19600 hypothetical protein
aHOG1409 hla HLAC0300 Hlac_300 hypothetical protein
aHOG1409 hut HUTA0646 Huta_0646 conserved hypothetical protein
aHOG1409 nrc1 VNG1534 vng1534 no entry
aHOG1409 hma Hma_10673 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


1534|hp|nrc1      MSMTDSK-FTQYLSDNPRMIGALFTMLLFLSTTGTAAAKHPIGIISGP
646|chp|hut       MSHSESE-ETSFLAQHPRMIGVLFMLLVLLTQMGAAAAGNASVTF-GP
300|hp|hla        MHES----VADYVAEHPKMAGVLFTALLLLTQAAPAAANQATSVA-GP
19600|hp|hbo      MSETDTNAVAQYLAEHPRMMGVLFTMLLLLSQAGSVAAGNNAGIY-GP
1326|hp|hhi       --------MREYLAEHPKMAGALFTLLMLLSQAGTAAAANNSSYI-GP
10673|hp|hma      --MSDTT-MREYLAEHPKMAGALFTLLMLLSQAGTAAANNN-IYI-GP
                            .:::::*.* *.**  *::*:  ...** :      **