HOG Organism Gene ID Name Annotation
aHOG1408 hhi 1805 HAH_1805 hypothetical protein
aHOG1408 hbo HBOR24350 Hbor_24350 predicted membrane protein, COG2860
aHOG1408 hla HLAC0980 Hlac_980 protein of unknown function UPF0126
aHOG1408 hut HUTA2719 Huta_2719 protein of unknown function UPF0126
aHOG1408 nrc1 VNG0298 vng298 no entry
aHOG1408 hma Hma_11209 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


1805|hp|hhi       ---------MTDPFAVMNAIGLVGFAFVGAAKAVEERYDVFGVTVVGVMTALGGGTTRDL
11209|hp|hma      ----------------MNAIGLVGFAFVGAAKAIEERYDVFGVTVVGVMTALGGGTTRDL
980|gene|hla      ----------------MNTVGLVAFALVGSSKAIREEFDLFGIVIVGLAMAFAGGATRDL
2719|hp|hut       MVETFLGEVLIDPFAVMNTIGLVAFALVGAAKAIRERFDVFGILVVGLVVAFGGGATRDV
24350|hp|hbo      ------MSITLDPFAVMNVVGLLAFAVAGSLKAADAGLDAFGVAVLGVITALGGGTTRDV
298|hp|nrc1       ----------------MNAVGLVAFATVGSLKAIDADFDVLGVAVLGVLTALGGGATRDV
                                  **.:**:.** .*: **     * :*: ::*:  *:.**:***:

1805|hp|hhi       LLNRVPNSLQSPGEVALSLLGVTAAVLFVHFLD---DGHQHPVVLTADAIGLAAFTTTGA
11209|hp|hma      LLNRVPNSLQSPGEVALSLLGVTAAVLFVHFLD---DGHQHPVVLTADAIGLAAFTTTGA
980|gene|hla      LVARVPLALQSPIEICLGLVGVGLAIGLNVVLS---SPETHPVTLVSDAIGLAAFATAGA
2719|hp|hut       LVGRIPLALQNVGEIALGTLGVSLALALSFLLD---SPDDHPITLVADAIGLAAFATAGA
24350|hp|hbo      LVNRPPASLATTWDMSVALVGVALAILLIRRTPEHVSVRDTPAFLVSDAVGLAAFAATGA
298|hp|nrc1       LVGSVPAMLQSTTDVGFALAGVVVAVVVARRVG--TEVLAHPVVDVPDAVGLAAFAASGA
                  *:   *  * .  :: ..  **  *: .        .    *   ..**:*****:::**

1805|hp|hhi       LLGHQAGLPVFAVVALATVNAAGGGAISDLLLGRTPFILREDFYASCAVIGGLAFWALAQ
11209|hp|hma      LLGQQAGLPVFAVVALATVNAAGGGAISDLLLGRTPFILREDFYASCAVIGGLAFWALAQ
980|gene|hla      IVATEVGVSAFGVVAIATINAVGGGAFADILLDRAPFILFEDFYASCAVLGGSAYWVVGT
2719|hp|hut       IVATEAGIPSFGVVAVATINAVGGGAYADILLDRSPFILFEDFYASPAVLGGLSFWAVTT
24350|hp|hbo      LVGAQAGLTPYGIVVLATVTAVGGGSLADLLIGRIPVVLREDFYATPALLGGIAFWVADA
298|hp|nrc1       LVGVGADVSPFGVVVLGTTTGVGGGLVSDVLLQRVPFVLTEDLYATCAIAGSTVLWVATA
                  ::.  ..:. :.:*.:.* ...***  :*:*: * *.:* **:**: *: *.   *.   

1805|hp|hhi       LGAAAGAASAGCALAVLLARGLGIGRGWSLPTVQAWERRDTQ----
11209|hp|hma      IGVSVSVASAGCALAVLLARGLGIGRGWSLPTVQAWERRDAQ----
980|gene|hla      LGATAGTAAAACAVVTVGTRLAAVTYGWNLPTAQNLELQRK-----
2719|hp|hut       VGWTVAPAAAMCATVTVGTRLVAVSRGWHLPTAQTLGLARDVDGSE
24350|hp|hbo      VGAPTGVPAGVCAGLVFATRMLALRYEWHLPEIRVEGRTGDS----
298|hp|nrc1       SGLGATIAAAAGAGVTLAVRLLAIRFEWALPTVRLNAPA-------
                   *  .  .:.  *  .. .*  .:   * **  .