HOG Organism Gene ID Name Annotation
aHOG1404 hhi 2160 HAH_2160 hypothetical protein
aHOG1404 hbo HBOR10130 Hbor_10130 hypothetical protein
aHOG1404 hla HLAC1692 Hlac_1692 hypothetical protein
aHOG1404 hmu HMUK1815 Hmuk_1815 conserved hypothetical protein
aHOG1404 nrc1 VNG1679 vng1679 no entry
aHOG1404 hma Hma_11617 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


2160|hp|hhi       MRYKVAPPARSH-SFLESARDAIPLVPDSEADCCRAIQTATDVSDRETAQKYLVFLQALG
11617|hp|hma      MRYKVAPPARSR-PFLETAREALPLVPDSEADCCRAIQTATDVSDRETAQKYLVLLQALG
1679|hp|nrc1      MQRKPVPPAPSSLAAVGDVRDATPLVPKPEDDCCRRLIERAGVEDRGTASAWLVFLSAVG
10130|hp|hbo      MKFKLVPEAPAQLDFVADAQRAVPLVPGTEDDCCARLMRRLDFESRDVARTWLTFLRAME
1692|hp|hla       MRLKPVPEPPDSLDDLRAFQRAVPLVPGSTDDCCARLRERRGLSDRQTANDWLAFLRALG
                  *. * .* .      :   . * **** .  ***  :    ....* .*  :*.:* *: 

2160|hp|hhi       LVAESDRG-YYRTRTDH---DQAALATAFEKSVFGVDVLVEALNS----EPVDTDDAFDA
11617|hp|hma      LVAESERG-YYRTRTDL---DRADLATAFEESVFGVDVLLAALDS----ESVDGDTAFDA
1679|hp|nrc1      VLVDDDAG--YARRGDVGVDDREALAAGFRENVFLGGDVVDALDD----TPAQPRDVFDA
10130|hp|hbo      LADETDDGSFVRRETDP---TEAHLTDAFERRVYGASDVLALLDD----DPKTIEDVFDG
1692|hp|hla       LARETSRG-FVRTDAEP---TPERVREGLRDGVLLVPEALTALRDASPADPLTPEGLFAA
                  :  : . *       :        :  .:   *      :  * .     .      * .

2160|hp|hhi       LRAEIPRWERERHA-DWEAVWQERTANLLEWAVLFGLAEKTTDG--------------YR
11617|hp|hma      LRAEIPRWERERHT-DWESVWQERTANLLEWAVVFGLAQKTDDG--------------YR
1679|hp|nrc1      VREQVPPWERAKRD-NWQAFWTGRVRRRLDWAALFGQAVRVDDTPC------------YR
10130|hp|hbo      FEDRVPVWEHHRAAENWRDVWTERVGRILDWAVLLDLAERRDGG--------------YV
1692|hp|hla       TRESVPRHDRARDP-NWEATWRERADRLLRWLALVDLAEEIEAGEAGESEAPEASSVAYV
                      :* .:. .   :*   *  *. . * * .:.. *                    * 

2160|hp|hhi       QPTEDGKDQ
11617|hp|hma      QPTENNENE
1679|hp|nrc1      RA-------
10130|hp|hbo      AANALDADR
1692|hp|hla       AGEAV----