HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0014COG0491KOG0813arCOG00504Zn-dependent hydrolases including glyoxylasesflavoprotein

HOG Organism Gene ID Name Annotation
cHOG0014 nrc1 VNG1327 fprA flavoprotein
cHOG0014 nrc1 VNG2080 gloB Zn-dependent hydrolases.including glyoxylases [General function prediction only]
cHOG0014 hmu HMUK2544 Hmuk_2544 beta-lactamase domain protein( EC:3.1.2.6 )
cHOG0014 hmu HMUK1181 Hmuk_1181 beta-lactamase domain protein( EC:3.1.2.6 )
cHOG0014 hma RRNAC1117 hypothetical protein
cHOG0014 hma RRNAC2800 fprA flavoprotein
cHOG0014 hwa HQ1377A hydrolase ( hydroxyacylglutathione hydrolase)
cHOG0014 hwa HQ2457A hydrolase
cHOG0014 hla HLAC0383 Hlac_383 beta-lactamase domain protein
cHOG0014 hbo HBOR27540 Hbor_27540 Zn-dependent hydrolase, glyoxylase-like( EC:3.1.2.6 )
cHOG0014 hbo HBOR14430 Hbor_14430 Zn-dependent hydrolase, glyoxylase-like( EC:3.1.2.6 )
cHOG0014 hut HUTA2884 Huta_2884 beta-lactamase domain protein
cHOG0014 hut HUTA1765 Huta_1765 beta-lactamase domain protein
cHOG0014 hvo HVO_0441 HVO_0441 fprA flavoprotein
cHOG0014 nph NP0092A hydrolase ( hydroxyacylglutathione hydrolase ) 8
cHOG0014 nph NP4032A hydrolase ( hydroxyacylglutathione hydrolase ) 7
cHOG0014 hhi 1724 HAH_1724 beta-lactamase domain-containing protein
cHOG0014 hhi 81 fprA flavoprotein/beta-lactamase domain-containing protein
MUSCLE (3.6) multiple sequence alignment


1377|gene|hwa       ----------------------------MTDVHAITADAEVFTCNAYLVSGDRPVLIDAG
383|gene|hla        -----------------------------MEPITVTADAEEFTCNAYLVSGEAPTLVDAG
27540|gene|hbo      -----------------------------MEIVTVTDGAEQFTCNAYLVLGERNVLVDAG
2080|chp|nrc1       -----------------------------MSVRVVTSGAASFTCNAFLVVGDTTTLVDAG
92|gene|nph         -----------------------------MDVYHVTANAETFTCNAYLVDGDRTVLVDAG
1765|gene|hut       -----------------------------MDVHNVTADAETFTANVYLATGDRPTLVDAG
12800|gene|hma      MFFGLTLGTAVATGGRDSTLKRAAPQASCMDVHNVTAEAETFTCNAYLATGEQTTLVDAG
81|gene|hhi         -----------------------------MDVHNVTAEAETFTCNAYLATGEQTTLVDAG
1327|gene|nrc1      ------------------------------MPTNLSAGVQAFTSNVFLVTGDRDVVVDAG
2457|gene|hwa       ------------------------------MIQNVASDVQAFSSNVFLVTGEINALIDAG
4032|gene|nph       -----------------------------MTVRNIARGIRSFTSNAFLVDGERTVLVDTG
14430|gene|hbo      ------------------------------MITSLAHDVQAFTSNVFLVTGDTTALVDVG
2884|gene|hut       ------------------------------MIHNVAADAGGFTSNVFLVTGDRQVLVDVG
11117|hp|hma        ------------------------------MIRNLARGQQAFTSNVFLVTGDRTVLVDVG
1724|gene|hhi       ------------------------------MIRNLARGQQAFTSNVFLVTGDRTVLVDVG
                                                      ::     *:.*.:*. *:  .::*.*

1377|gene|hwa       AMPGAVDIIDNIVDD-----LEAVYLTHQHTDHVAELDSILDKFDAE-LYAYS-DHPRQD
383|gene|hla        TMPGVDDVIADALDEAGVDGLDRVVLTHQHHDHVGQLDAVLDRFDAT-LYANA-AHPRRD
27540|gene|hbo      TMPGVETVVADHTDE-----LDAVVLTHQHTDHIGELDAVLDRFDAD-LYAYG-DHPRRD
2080|chp|nrc1       AYDGVADEIRAHVDA-----LDQVVVTHQHTDHVQQLDAVVDAFDGPDVYAYA-DHPLRT
92|gene|nph         AMDGVVDVVDEYTDM-----LDAVVLTHQHSDHIAELDAVLDAFDAP-LYAYD-DHPQRT
1765|gene|hut       AMDGVVDVIREYTDE-----LDSVVLTHQHGDHVAQLDAVLDAFDAE-LYANA-DHPRRT
12800|gene|hma      AMRGVVDVIREHADA-----LDAVVLTHQHGDHVQRLDTVLDAFDAP-LYAYG-SHPRRD
81|gene|hhi         AMRGVVDVVREHVDA-----LDAVVLTHQHGDHVQQLDAVLDAFDAP-LYAYS-SHPRRD
1327|gene|nrc1      ANYDVVAAVRDHGVT-----PDAVVITHPHPDHVGNLDALVDAFDPT-VLGFD-GVADAD
2457|gene|hwa       ANFDVVSQIQEHTEQ-----IDRLYLTHTHVDHVKNIPSVRDAFDVE-TWGYDTTHDIVD
4032|gene|nph       NDFDAVSNVDAATGD-----LDAVVLTHTHPDHVGNVPAVVEAFDVE-VWGYDGDHDLVD
14430|gene|hbo      ANFDVVSRVRDHVDE-----LDRVYITHTHRDHVDNVAAVREAFDVE-TWGFDPDQSEVD
2884|gene|hut       NDFDVVARVREHVED-----LDAVVLTHTHPDHVGNLDAVTEAFDAP-VVGYDPDASGVE
11117|hp|hma        NEFDVVSTVEEHVDD-----IDAVAVTHTHYDHVENLDSVVDAFDVP-VYGYDTDQDGVE
1724|gene|hhi       NEFDVVSAVEEHVDD-----IDAVAVTHTHYDHVENLDSVVDAFDVP-VYGYDTDQDGVE
                       ..   :            : : :** * **:  : :: : **     .         

1377|gene|hwa       STLEDTDTVEIGDEPFEVVYTPGHASDHVAFVGNTR--VFSGDVVVYNDGAFDDGSFGRT
383|gene|hla        VAIGDGDEILVGDEPCEVVETPGHAADHISLVGDDR--VYSGDVVVYNDGAFDDGSFGRT
27540|gene|hbo      EALEDGDVLQMGEETFEVVYTPGHASDHISLVSEKR--IFSGDVVVYNDGAFDNGSFGRT
2080|chp|nrc1       HALADGDTVQVGDQAADVVFTPGHAPDHVSLVTETA--LFAGDVVVHDDGAFDDGSFGRT
92|gene|nph         NELDDGDQIFMGDEPFDVVYTPGHADDHVALVSETT--LFSGDVVVHDDGAFDYGSFGRT
1765|gene|hut       NGLDDGDTIQMGDETFEVVYTPGHADDHVSLVSETT--LFSGDTVVHDDGAFEGGSFGRT
12800|gene|hma      HALADGDTLTVGDEECEVVYTPGHADDHVSLVSESA--LFSGDVVVHDDGAFDDGSFGRT
81|gene|hhi         HELADGDTLTVGDEDCEVVYTPGHADDHVSLVSESS--LFSGDVVVHDDGAFEGGSFGRT
1327|gene|nrc1      RALADGDEIRLGDDDYVVLHTPGHEPHHVCLYSPAAGVLFSADLV------FANGSFGRT
2457|gene|hwa       HAIQDEESIPIGDERYISLHTPGHKPDHLCFYAANIGICFAGDLI------FANGSFGRT
4032|gene|nph       HEVGDGDTVDIGDHPYEVLHTPGHKEDHVCLYAPTAATLFAGDLV------FANGGFGRT
14430|gene|hbo      HAIADGETVQIGDDDYEALHTPGHKNDHLCFYSRDASVLFAGDLV------FANGSFGRT
2884|gene|hut       QAIDDGDTVDMGDHTYTALHTPGHKDDHVCLYAAGSGILFAGDLV------FENGGFGRT
11117|hp|hma        YAIADDETIQLGDHDYRALHTPGHKNDHLCFYSDDAGVLFAGDLV------FANGSFGRT
1724|gene|hhi       HAIADDGTIQLGDHDYRALHTPGHKNDHLCFYSDEAGVLFAGDLV------FANGSFGRT
                      : *   : :*:     : ****   *:.:        ::.* :      *  *.****

1377|gene|hwa       DMTGQSRERLITSLQRLLERL-PQTVNELYAGHGDVYYGSPGDDTIDSVKTIIERALMRA
383|gene|hla        DMAGQSREVLIESLHTLLDRL-PDTASAMYPGHGDVYR---ASDGPDTVREVIERATERA
27540|gene|hbo      DMSGQSRERLVESLRTLLDRI-PETVEELYAGHGDVFR---SESGGDSVQDVIERALSRA
2080|chp|nrc1       DMPGQSRERLIGSLRELLARM-PDSVSEFYAGHGGVFE---GD-----VRAVAERALDRA
92|gene|nph         DMPGQSRERLIESIQTLLDRM-GEDVEHMYAGHGDTFH---GD-----VRDVVETALQRA
1765|gene|hut       DNPGQSRERLIESIRDILDRM-PETVEHMYSGHGGAFH---GD-----VREIVETALERA
12800|gene|hma      DRPGQSRERLIESIERILDRM-PAGVEHMYSGHGGVFH---GD-----VREVVERALERA
81|gene|hhi         DRPSQSRERLIESIERILDRM-PAGVEHMYSGHGGVFH---GD-----VREVVERALDRA
1327|gene|nrc1      DLDGGDRETLVESIDRLADTVAGEELTALYPGHGPSVT---SD-----PAADIDLAARSA
2457|gene|hwa       DLEGGNRKTLIQSIDRIAGTV-TDNLTAIYSGHGPAIT---TD-----PKENIDMAAQAA
4032|gene|nph       DLPEGDRDQLIESIEYLLDAV-DESLSTMYVGHGPTVD---AD-----PRHHIELAHGAA
14430|gene|hbo      DLEEGDRPTLIESLDRVRETI-DETLSEMHTGHGPSVT---ER-----PFDDVELAGRAA
2884|gene|hut       DLEEGDRSLLVESIRRVLDTV-DADLAVMHTGHGRSIQ---TD-----PYRNIELAAQAA
11117|hp|hma        DLNEGNRDLLVDSIERVLSVT-DEDLQEMHTGHGPSIT---DA-----PYQDIELALQAA
1724|gene|hhi       DLDEGDRSLLVDSIEQVLSVV-DEDLQEMHTGHGPSVT---DA-----PYQDIELALQAA
                    *    .*  *: *:  :           :: ***                   : *   *

1377|gene|hwa       ERRKLKYPNN-
383|gene|hla        ERREPKYPDE-
27540|gene|hbo      ERREPKYPDD-
2080|chp|nrc1       QRRDPKYPDDQ
92|gene|nph         EKREPKYPEE-
1765|gene|hut       ERREPKYD---
12800|gene|hma      ERREPKYPDD-
81|gene|hhi         QRREPKYPDE-
1327|gene|nrc1      RFQ--------
2457|gene|hwa       RM---------
4032|gene|nph       RMR--------
14430|gene|hbo      RMR--------
2884|gene|hut       RF---------
11117|hp|hma        KF---------
1724|gene|hhi       KF---------