HOG Organism Gene ID Name Annotation
aHOG1399 hhi 2902 yusM proline dehydrogenase
aHOG1399 hhi 1699 HAH_1699 hypothetical protein
aHOG1399 hhi 4443 HAH_4443 hypothetical protein
aHOG1399 hbo HBOR20520 Hbor_20520 L-proline dehydrogenase( EC:1.5.99.8 )
aHOG1399 hbo HBOR28400 Hbor_28400 L-proline dehydrogenase( EC:1.5.99.8 )
aHOG1399 hla HLAC0351 Hlac_351 Proline dehydrogenase
aHOG1399 hla HLAC1151 Hlac_1151 Bacterio-opsin activator HTH domain protein
aHOG1399 hmu HMUK1107 Hmuk_1107 Proline dehydrogenase( EC:1.5.99.8 )
aHOG1399 nrc1 VNG2120 yusM proline dehydrogenase
aHOG1399 hma Hma_12471 yusM proline dehydrogenase
MUSCLE (3.6) multiple sequence alignment


1151|gene|hla       MATTDTGGVEEWSGTRLTLDLWHPNCWAIEATSQTDGGVLAHAIYNTPKADGDTPNSVNG
4443|hp|hhi         ------------------------------------------MTEIQPKATAEYCRFCGD
1699|hp|hhi         ------------------------------------------------------MNVFSE
351|gene|hla        ---------------------MIPPIARRFVAGESAPEAIEHARARNEDGVAVILNLLGE
20520|gene|hbo      ---------------------MIPPVANNFVAGEDVEGVLSHVAETNERGISGIVNLLGE
28400|gene|hbo      ---------------------MIPPIASRFVAGETSAAALDHTRKVNKDGVKVILNLLGE
2120|gene|nrc1      ---------------------MIPPIANRFVAGETPAEAIEYAADLNDRGVTAILNLLGE
2902|gene|hhi       ---------------------MIPPIANNFVAGETAPGALDHVASLNDDGVKGILNLLGE
12471|gene|hma      ---------------------MIPPIANNFVAGETAPGALDHVASLNDDGVKGILNLLGE
                                                                           .  . 

1151|gene|hla       LFTAFADTNEEVEELLDAIRASDRGG-------------------DLLELQERFGRARDA
4443|hp|hhi         RTAD---ISGEAYTYVRLSDEVGR-----------------------------------E
1699|hp|hhi         QTGD--------------------------------------------------------
351|gene|hla        HYDDPADARADTDAYLALLTDIADSGLDASISVKPSQIGLDVSDECFEGHYREIVARAHE
20520|gene|hbo      HYDDRSDAAADTEVYLELAEQIDERDLDCCLSVKPSQIGLDIGEDVFRRNLSRIVEHADE
28400|gene|hbo      HYHERAPADADAAAYLELIEDVGDSELDACVSVKPSQIGIDVGDEVFRENYLRIAEKGAE
2120|gene|nrc1      HYHERPPADEDAAAYRRLVADVGDSDVDACVSVKPSQIGLDVGPEVFAENLETIAAAAAD
2902|gene|hhi       HYDERQPADEDADQYTELVKEIDRSGLDCAISVKPSQIGLDVGDDVFVENLERIVAAGDD
12471|gene|hma      HYDERQPADEDADQYVELIQEIDKSGLDCAVSVKPSQIGLDVGDDVFVENLERIVAAGDD
                                                                                

1151|gene|hla       PGNVVREFFLEYDPADMMCPTLLEHGFVHSAPVRIEGGREEWQVCFVGERTEIRESLDAV
4443|hp|hhi         DGVFWF------------------------------------TICRECTLQD-RDNVEQA
1699|hp|hhi         -----------------------------------------------GSVVSIPNNLDNL
351|gene|hla        LDAFVWCDMEDADTTDATLDAFESIAEEYPWSV---------GQCIQSNLKRTREDLDRL
20520|gene|hbo      HGIFVWVDMEDHDTTDATLDAFEENAREY-GDV---------GVCVQANLKRTAEDLRRL
28400|gene|hbo      HDVFVWCDMEDADTTDVTLDVFEEAAREYDGGV---------GQCVQANLKRTGDDLERL
2120|gene|nrc1      HDVFAWVDMEDHETTDATMDTFESLARTHAGNM---------GLCVQANLKRTEQDLDRL
2902|gene|hhi       HGVFVWVDMEDYTTTDVTLDAYERLVTDHEGGV---------GVCTQANLKRTPEDLERL
12471|gene|hma      HGVFVWVDMEDYTTTDVTLDAYERLVTEHEGGV---------GVCTQANLKRTPEDLERL
                                                                          :.:   

1151|gene|hla       QENAG------------AEVTVQSMSSSGQPGQTPREQRLDTLTTTQR------------
4443|hp|hhi         ASL------------------------FHEADRDHL------------------------
1699|hp|hhi         TIS------------------------TNKPYKHVLVYVLGTYQTDKRVGT---------
351|gene|hla        SDVPGKIRLVKGAYDEPEAIAHKEQSRVDEAYREDLRFLFERRDRGIAVGSHDPAMISLA
20520|gene|hbo      ADLPGKVRLVKGAYDEPKEIAYRDKATVDEKYREYLTFMFEEFDDGIAVGSHDVAMINHA
28400|gene|hbo      ADVPGKIRLVKGAYDEDPEISYKQKSKVNEKYEEYLEFLFEEYVGRVAVGSHDPKMISAA
2120|gene|nrc1      ADVPGKVRLVKGAYDEPDDVAYQDKPDVNEAYRTHLEFMFREFDDGVAVGSHDPAMISYA
2902|gene|hhi       APLPGKVRLVKGAYSEPKEVSYKKKERVNEAYRDCLELMFEEFDGGIGVGSHDPAMIDYA
12471|gene|hma      APLPGKVRLVKGAYSEPEEVSYKKKERVNEAYRDCLELMFEEFEGGIGVGSHDPAMIDYA
                                                 :                              

1151|gene|hla       ----EVYEHAREAGYY-EWPRGASTRDLADDLDVSKTTLLEHLRK---------------
4443|hp|hhi         --------VTCDVCGA-VGCQSASTRQPAAE-----------------------------
1699|hp|hhi         --------TDYEVSVTRVSHRHDGMDVLDGD--YDYIHLLPVGSK------------GSC
351|gene|hla        DRLAREHGADYEVQML-MGVREDAQRDLAAQ-GVDVAQYAPYGTKWLSYFYRRVRERRQN
20520|gene|hbo      ADCYREYGTPFEVQML-MGVRENLQDEL-VD-SMPVYQYVPYGPKWFSYFTRRVRERKEN
28400|gene|hbo      EELANEYDRDYEVQML-MGVRDDTQRELSAE-GTEVWQYAPYGDKWFSYFYRRARERKEN
2120|gene|nrc1      AELHEEYGTDYEVQML-MGIREDAQTELAAT-GVPTYQYVPYGGKWFSYFYRRAMERKEN
2902|gene|hhi       KDLHDEYGTDYEVQML-MGVRDDAQRDLAAE-GVPMWQYIPYGDKWFSYFYRRVRERKEN
12471|gene|hma      KDLHDEYGTDYEVQML-MGVRDDEQRDLAAE-GIPMWQYIPYGDKWFSYFYRRVRERKEN
                               :.       .                                       

1151|gene|hla       ---AESKLLDP
4443|hp|hhi         -TYRLASVIS-
1699|hp|hhi         DVVTLTEVSA-
351|gene|hla        LGFAVRAVLGR
20520|gene|hbo      ALFALRAVFG-
28400|gene|hbo      ALFALRAIVGI
2120|gene|nrc1      LVFALRAVLGR
2902|gene|hhi       ALFAVRAVLS-
12471|gene|hma      ALFAVRAVLS-
                           :