HOG Organism Gene ID Name Annotation
aHOG1393 hhi 991 baeS putative light-sensing histidine kinase
aHOG1393 hhi 5035 oye3 light and oxygen sensing histidine kinase
aHOG1393 hbo HBOR32190 Hbor_32190 PAS domain S-box
aHOG1393 hmu HMUK3311 Hmuk_3311 multi-sensor signal transduction histidine kinase
aHOG1393 hut HUTA1571 Huta_1571 multi-sensor signal transduction histidine kinase
aHOG1393 nrc1 VNG2334 prh phoR-like homolog (Reciever.2 PAS/PAC.HisKA.HATPase)
aHOG1393 hma Hma_7156 oye2 light and oxygen sensing histidine kinase
MUSCLE (3.6) multiple sequence alignment


991|gene|hhi        ------------------------------------------------------------
2334|chp|nrc1       MTTLDAGAASPVHVLYVNDDDDFAELTRRKLQSAPASFTVTTVGTAADALARLDESAIDC
5035|gene|hhi       -------------------------MAETKLVNISSGFEVTAVGAVEAALDLLVTSTVDC
7156|gene|hma       MAYAGDGTPDTIHVLYVNDDGDFAELAQTKLRNISSDFDVTAVGTIEAALDLLATSAIDC
32190|gene|hbo      MAGISD---TPIRVLYVNTDEDFTELVQTKLCQADADIEFIHATNARTAVETVSVERIDC
1571|gene|hut       MTRFDDGKTGPITVLYVNDDRSFGDLVRTKLSRC-GEIDVETATAAETAMEKLATTEFDC
                                                                                

991|gene|hhi        ------------------------------------------------------------
2334|chp|nrc1       VVTSYSLPDTTGIDLLERIHDTDHDPPTILFTGRGSERIASEATRAGVSDYLPIHAGQRS
5035|gene|hhi       VVTSYSLPDGTGIDLLDRLQAEQYEIPTILFTGRGSERIASEATQAGVSDYIPIHAGENS
7156|gene|hma       VVTSYSLPDGTGIDLLDRLQAEQDERPTILFTGRGSERIASEATQAGVSDYVPVRAGQNS
32190|gene|hbo      VVTAYSLADETGIDLTESIRQQDEDLPIVLFTGQGSEEVASESTRAGITDYITIRTDRDN
1571|gene|hut       VVTSYALPDGTGIDLLEQIQAEHDDLPTVLFTGRGSEEVASRATRADVSDYIPIRPNQES
                                                                                

991|gene|hhi        ------------------------------------------------------------
2334|chp|nrc1       FELLARRVRTLTEAARKETVAEEMSDRFRRTLERSTDAVYAVDEDWRIEYMNETMADRID
5035|gene|hhi       FELLGRRIQTLVEAARKQAVAERLSDRFQRTLERATDGIYAVNDEWRIEYINEKMARRVD
7156|gene|hma       FELLASRIQTLTEAARKQAAAERLSDRFQRTLERATDGIYAVDNEWRIEYINEKMAKRVD
32190|gene|hbo      FELLVHRIQTLVQAARERRAAERINNRFQRTLERTADAIYAVDTEWRIEYMNEQMADRVG
1571|gene|hut       FELLARRIETLVDAARKRAAADRMTDRFRRTLERATDAIYAVDTDWRIEYMNEKMGDRVD
                                                                                

991|gene|hhi        -----------------------------------MVAFD--------------------
2334|chp|nrc1       RDRDAVVGTVLWEEFPSLVGTPLEEQYRTAMETGESVSSEQRLGAPFDYWVDVRAFPDDD
5035|gene|hhi       RNPDDIIGASIWEEFPSIVGTELEDKYRTAMETGEPVSFEQYLGEPFDYWVEVRVFPDDD
7156|gene|hma       RDPDAVVGAVIWEEFPSIVGTELEEKYRTAMETGDPVSFEQYLGEPLDYWVEIRAFPDDD
32190|gene|hbo      RDPETVVGTVLWEEFPTITGTKLEEQYRTAMETGEPISFEQYLEEPFDYWVKVRAFPDED
1571|gene|hut       RDPEEVVGNVLWEEFPAVVDTELEDRYRTAMETGESVSFEQYVGEPFEYWVDVRVFPDED
                                                        :: :                    

991|gene|hhi        ------------------------------------------------------------
2334|chp|nrc1       GLTVFSQEITDEREQALALERSETILRHIHDVVFVVDDAGVVEFANAAAQRVIGGTQSAP
5035|gene|hhi       GLTIFSRETTAERERELELERSETILENIHDAVFVLDDEGTIEFANAASKRLIAGDQSTQ
7156|gene|hma       GLTVFSQETTAERERELELERSEAILENIHDVVFVLDDEGTIEFANTASRRLVSGDRATK
32190|gene|hbo      GLTVFSREITDERERQQELERNEAILQKIHDVVFVINEDGRIQFANSAAARVLERSRES-
1571|gene|hut       GLTVFSQEITDRKQQQ--------------------------------------------
                                                                                

991|gene|hhi        ------------------------------------------------------------
2334|chp|nrc1       LVGHHLPTIIEDRGSTADATSVSDAIDSTLAELESDGGTAGFYDVNLPIDFDAGTDTRTL
5035|gene|hhi       IAGQQLETVVGNRISTSDTEQFTSAVRSTLNDIEGDGGVTGLYDADLQLDITAEGDKRTF
7156|gene|hma       ITGQQLEAVVGDRMSKSDTERFTTAVESTVDDIETDGGVTGLYDTDLQLDVTTDGGKRTL
32190|gene|hbo      LEEERLSGIVSSRVSDSDAREFKSAVTETLQEIDGDGGVTGLYDFDLQLGLRVGTKRRVF
1571|gene|hut       ------------------------------------------------------------
                                                                                

991|gene|hhi        ------------------------------------------------------------
2334|chp|nrc1       DVRFTPFRTAADRQVLVVGRDITEQSDVRRHLERERDALREIQRVVAETELSVDERLEAL
5035|gene|hhi       DVRVTPFQSNKSNQALVVARDITEQSDVKRQLERERDALRELQTVMAKSDVSAETRLQEL
7156|gene|hma       DVRVTPFRGNADRQVLVVARDITEQSRAKRQLEQERDALRELQTVMARGDISAETRLEEL
32190|gene|hbo      DVRLTPFQSTMNRQVLVVARDVTEQSQARNQLKRERDALRELQTVMADSELSTDDRLTEL
1571|gene|hut       ------------------------------------------------------------
                                                                                

991|gene|hhi        ------------------------------------------------------------
2334|chp|nrc1       LAVGCQALGLEIGIVSHIHGEQYTVKAAHTSGVDIAPGDEFDLATTYCESVVGSDAVCSF
5035|gene|hhi       LELGCRMLDLEIGIVSRVQGDDYTVKAVHAPESEIESGDQFDLESTYCEAVIGTDSVCSF
7156|gene|hma       LDLGCQTLGLDIGIVSHVQGDDYTVRAVHAPDAEIESGDQFDLESTYCAEVVGTDAVCSF
32190|gene|hbo      LEVGCQTTGLEIGIISKIEGDKYTVRSVHTPDGSIETGDRFDLESTYCEVVVAQDSVCAF
1571|gene|hut       ------------------------------------------------------------
                                                                                

991|gene|hhi        ------------------------------------------------------------
2334|chp|nrc1       SDATADGRETHPAYEELGLQSYVGAPLIVDGDRYGTINFSSPATRVADFDAIEETLVELL
5035|gene|hhi       ADAVADGRETHPAYREFELESYIGVPLVVDGTRYGTVNFSSPTTRVDSFGALERTFVKLL
7156|gene|hma       ADAVTEGKETHPAYRELELESYIGVPLIVDGVRYGTVNFSSPATRVAPFGALERTFVKLL
32190|gene|hbo      SDAISAGKSSHPAYQQFELESYIGVPLVVDGNRYGTLNFSSPTTRESEFGTLERTFVELL
1571|gene|hut       ------------------------------------------------------------
                                                                                

991|gene|hhi        ------------------------------------------------------------
2334|chp|nrc1       AELVSAELSRGRDRAELQRRQFLFERIQETANVGVFEYAPSTGSLEWSDGVRRIHGVDPG
5035|gene|hhi       SELVSAEISRGRDHADLQRQEFLFERVQDIADIGVWEYFPSTGALDWSDGVRRIHGVDDD
7156|gene|hma       SELVSAEISRMQDQTDLKRQEFLFERVQNIADIGVWEYFPATDSLDWSDGVRRIHGVADE
32190|gene|hbo      AELVSSELSRDRSRT---------------------------------------------
1571|gene|hut       ------------------------------------------------------------
                                                                                

991|gene|hhi        ------------------------------------------------------------
2334|chp|nrc1       YEPSFDDAIDAYHPDDRETIAAAVDRALDEGEPYDLDLRIVRPDGVVRDVRAWGERVDSP
5035|gene|hhi       YDPVLDDAIEFYHPDDRETITTAVERAIADREPYDLDLRIVRTGGDVRDVRAWGERVDEP
7156|gene|hma       YEPSLDDALGFYHPDDRDKISKAVEQTIADREPYDIDLRIVRTDGDVRDVRAWGERVDDP
32190|gene|hbo      ------------------------------------------------------------
1571|gene|hut       ------------------------------------------------------------
                                                                                

991|gene|hhi        ------------------------------------------------------------
2334|chp|nrc1       QHGARTLRGVIQDITGRKSREREHKALAEEYEALLETSGDAIFLLDVDTTGDEPRFEFAR
5035|gene|hhi       QDDEPVIRGVFQDITERKAEERAHRELAEEYEALLDTSGDAIFMLDVDTAGDERAFEFAR
7156|gene|hma       QDDEPVLRGVFQDITERKARERAHQELAEEYEALLNSSGDAIFMLDVDTAGDERAFEFAR
32190|gene|hbo      ------------------------------------------------------------
1571|gene|hut       ---------------------REYQELAEEYDALLDTSGDAIFVLDVDMSGQDPEFTFAQ
                                                                                

991|gene|hhi        ------------------------------------------------------------
2334|chp|nrc1       LSPGYEAQTGLETAAVKGKTPREVFGDEQGSEVAANYRRCVDEGAPISYREELDVGPDAR
5035|gene|hhi       LSPGYESQTGLTTDEVRGQTPREVFGAERGAELAANYTRCVEQRAPISYQEELDIAPDAR
7156|gene|hma       LSPGYESQTGLTTEDVRGRTPRDIFGDERGAELAANYTRCVEERAPISYREELDIADDAR
32190|gene|hbo      ------------------------------------------------------------
1571|gene|hut       LSPGYETQTGLSTDEVKDRTPRDVFGEERGAELAANYAECVEQREPISYREELSVAPDAR
                                                                                

991|gene|hhi        ------------------------------------------------------------
2334|chp|nrc1       FWDTGLAPVVVDGEIVRIVGIARNVTDQVERERSLEATNQRLESLIEATPLAVMEIDPDG
5035|gene|hhi       FWDTSLAPVMLGDEIVRIVGIARNVTEQVKRERELETTNQRLESLIEATPLTVMEIDTDG
7156|gene|hma       FWDTSLAPVILDDEIVRIVGIARNVTEQVERERKLETTNQRLESLIEATPLTVMEIDTDG
32190|gene|hbo      ---------------------------------ELEQTNQRLESLIEAAPLTIMEIDRDG
1571|gene|hut       FWETSLAPVIVDDEIVRIVGIARNVTEQVQRERKLEQANQRLEGLIEATPLTIMEIDADG
                                                                                

991|gene|hhi        ------------------------------------------------------------
2334|chp|nrc1       TVTRWNDEAESMFGWTREEVVGEFNPVVPDSQRDEFEDHRQRVLGGERIRGMELRRRTKS
5035|gene|hhi       TVIRWNDGAENMFGWSREEVLGEFNPMVPDEQQAEFESHRQRALSGEPIRGKEIRRETKD
7156|gene|hma       TVTRWNDGAENMFGWSRAEVLGEFNPIVPDEQQAEFESHRERVLSGEPIRGKEVRRKTKA
32190|gene|hbo      EVLLWNRGAEQMFGWSREEVVGEFNPIVPKEGQSEFKQHRQQALRGERIRGKEIQRQTKD
1571|gene|hut       EVIRWNEGAEEMFGWSREEVLGEFNPIIPEDQQTQFDAHRRAALNGKPIRGKEIQRETKE
                                                                                

991|gene|hhi        ---------------------------------------LDSFEAVTQQLMAAESEREIC
2334|chp|nrc1       GGDLDVLLSAAPVPGADGETTSLLAVLEDITPQKQLEAKLRALQETARRLTSAQSSAAVG
5035|gene|hhi       GEVLDLLLSVAPITAPDGEITSILAVLEDITDQKQLESKLRSLQATAQRLSGAQSSAEIG
7156|gene|hma       GEELDLLLSVAPIAAPDGEITNVLAVLEDITEQKQLESKLRSLQETAQRLSAAQSSAEIG
32190|gene|hbo      GERLDLLLSVAPITEAGGEVTSIIAVLDDTTEQKRLENQLRALQETAQQLSVARSREEIG
1571|gene|hut       GRRLDLLLSVAPIEDSNGEVTSILAVLEDITEQKHLENRLRSLQRTAQQLSAAQSTEEIA
                                                           * ::: .:..*  * *   : 

991|gene|hhi        EIAMSGISSVFDVPLGALWLYDSDASELQLAASTERADEVFDWPVTYRPGNSLSWEAFEQ
2334|chp|nrc1       EIAVEVAADVLGYDLTAVWEHDEQSASLVPLAATGATREAFDDIPTLQSGDSLAWDAFES
5035|gene|hhi       DIAVEAAVDILGFELTGIWESANQADELVPLTASAATRELLGELPRLESGEALAWEAFEA
7156|gene|hma       DIAIEAAVETLGFELTGIWEYADQTDELVPLTASAATSERFGELPRLQSDESLAWEAFAA
32190|gene|hbo      DIAVEAAVDVLGFDITGIWRHDDRENALVPITETTAARERFSESPRFTPGDSLAWEVFES
1571|gene|hut       NIAVGAAVEILGFEITGIWEYDEREHALIPITETAEARELVGESPRFDPGDSLAWKAFDT
                    :**:    . :.  : .:*   .    *   : :  : * ..      ..::*:*..*  

991|gene|hhi        DEVRTYSELDDEQRQYNENSPVSSEIILPLAEYGVINIGSLAPVTFDGETLRLARMYATH
2334|chp|nrc1       AELHVYDDLEHQSDLVASGTPLESGLFVPLGGFGVLGVGATAGQTFSDTDVDLFRILGST
5035|gene|hhi       SELRKYDDLQSEVTLGKADAQLRSGLFVPLGEFGLIGVGTTQEQTFSDTDVDLFQILGAT
7156|gene|hma       SEMRRYDDIQSVASVGEADRSLRSGLFVPLGEFGLICVGTPQEQIFSEADVDLFQILGAT
32190|gene|hbo      REIHVCDDVETSSSVYNPNTQIKSEIYVPLGDHGLISTGSTVGQRYSETEVDLFRILGAT
1571|gene|hut       GELQVFDDVREDDERYNEDTRIRSEIQVPLGDYGLISTGSPTTREFSETDVDLFRILGAT
                     *:.  .::         .  : * : :**. .*::  *:     :.   : * .: .: 

991|gene|hhi        VQAALQKAEREHDLRVQRDRMEQFIGVVSHDLRNPLHVVEGRLELVRETGDLSHLEDAEE
2334|chp|nrc1       VAAALARATRETELQRQNERLDQFASVVAHDLRNPLSVATGFLDIVADTGELEYLDRIES
5035|gene|hhi       VEAAFTRASRETELQRQNERLDEFASVVAHDLRNPLSIAIGFLDIVEETGDLSYLERIEA
7156|gene|hma       VEAAFTRASRETELQRQNERLDEFASVVAHDLRNPLSIAIGFLDIIEESGDLSHVDRIEA
32190|gene|hbo      VEAALARADREEELRRQNERLNEFASVVAHDLRNPLTIASGFLEVVKETDDPTHYEKIES
1571|gene|hut       VEAALARASREAELKRQNERLDQFASVVAHDLRNPLTVAMGFLEVAAETGDPDHFEKVEA
                    * **: .* ** :*. *.:*:::* .**:******* :. * *::  ::.:  : :  * 

991|gene|hhi        GVARMEALIDDLLTLAKKGYAVEDRTAISLDTIVEQTWEMARTADATLRVEGSAPVF-GD
2334|chp|nrc1       AHDRMARLIDDLLTLASGESTVTDAECVDLHAVTTESWGYVDTAEATLCVRDDLRTVSGD
5035|gene|hhi       AHDRMEQLIDDLLTLARGETTITDTKQIDLKTVTTEAWGYVDTADATLTVAEAVPTVAGD
7156|gene|hma       AHDRMERLIDDLLTLARGETTVTDTKQIDLATVTTEAWGYVDTVEATLTVAETVPTVAGD
32190|gene|hbo      AHSRIERLIDDLLTLARGETLIEDTEQINLTDIATEAWGYVDTSQATLTVCDQAPVVAGN
1571|gene|hut       AHDRIERLIEDLLTLARGETTIEDREQIDLGAVAREAWGYVDTSEATMEVAEGVPVVAGD
                    .  *:  **:******     : *   :.*  :. ::*  . * :**: *     .. *:

991|gene|hhi        QNRLKQVFENLFRNAADHAGDDVTVWVGPILDDGTAEIDTADERTEGRVTGFYVADDGPG
2334|chp|nrc1       GSRLTQLFENVFRNAVEHGGAAVTVTVGQLGDRE----------------GFYVADDGDG
5035|gene|hhi       AGRLTQLFENLFRNAIEHGGDAVTVTVGQLDSPD----------------GFYVADDGDG
7156|gene|hma       AGRLTQLFENLFRNAIEHGGEAVTVTVGQLDGGE----------------GFYVADDGDG
32190|gene|hbo      AGRLTQLFENLFRNAVEHGGTDVTITVGGLDDRE----------------GFYVEDDGQG
1571|gene|hut       AGRLSQLFENLFRNAVEHGGKDVTITVGKRAD-G----------------GFYVADDGEG
                     .**.*:***:**** :*.*  **: **   .                  **** *** *

991|gene|hhi        IPSDELDSLLSVD-SFSGSDTGLGLSIVTQIIDAHGWDISVTESRAGGARFEVTDGTKPV
2334|chp|nrc1       IPEDERGDVLDHGVTSSDAGTGFGLSIVEDIAKAHGWAVVVTAGADGGARFEFETDP---
5035|gene|hhi       IPPAKREEVLEHGVTSTKGGTGFGLSIVADIAKAHGWTVRVTESTAGGAQFEFRY-----
7156|gene|hma       IPPAKRGDVLEHGVTSTKGGTGFGLSIVEDIAKAHGWTVRVTEGAAGGARFEFCY-----
32190|gene|hbo      ISPERREDVFEHGVTSNKGGTGFGLSIVADIARAHGWTVSVAEGTDGGARFVFETDS---
1571|gene|hut       IPLENRESVFDHGVTTNEGGTGFGLSIVEDIAKAHGWTVSVSESDEGGARFDFDID----
                    *.     .::. . : . ..**:***** :*  **** : *: .  ***.* .       

991|gene|hhi        SPFHSW
2334|chp|nrc1       ------
5035|gene|hhi       ------
7156|gene|hma       ------
32190|gene|hbo      ------
1571|gene|hut       ------