HOG Organism Gene ID Name Annotation
aHOG1377 hhi 3058 HAH_3058 Rhomboid family protein
aHOG1377 hhi 2560 HAH_2560 hypothetical protein
aHOG1377 hbo HBOR34800 Hbor_34800 uncharacterized membrane protein
aHOG1377 hla HLAC0158 Hlac_158 Rhomboid family protein
aHOG1377 hmu HMUK1002 Hmuk_1002 Rhomboid family protein
aHOG1377 hut HUTA1458 Huta_1458 Rhomboid family protein
aHOG1377 hwa HQ2329 glpG rhomboid family protein
aHOG1377 nph NP3724 homolog to GlpG-like protein
aHOG1377 hma Hma_12647 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


2560|hp|hhi        ----------------------------------------------MTPLPSLAVTAAAL
2329|gene|hwa      -MGNQQPRRSQSSGKSGDEILPRTTVRGGRSPTAETVVLLCGFFLIQYPLSAIGLV-GLF
1458|gene|hut      ------------------MDRAGSTAQAS-SPTTVLIGVLVVVFLFQELLGVFGVS-FAF
34800|hp|hbo       ------------MSSTNELPDRRSNLIFG-NPVAETLLAMLFVSVLTWTVSFIGLV-GLF
158|gene|hla       -----------------------------MRATLETLAIASLVGIAQGALRLVDLA-AIF
3724|gene|nph      ---------------------------MSSRPTLQALAACVVVFLLQQAGGAVGLGDAVF
3058|gene|hhi      ---------------------------------MVTLAVIGAVFLAQQAVGVVTAPRSLF
12647|hp|hma       MPRMRSETEGCPSVSCVESDNIGTMKPLRQSPTVVTLAVIGAVFLAQQAVGVVTAPRSLF
                                                                       .      :

2560|hp|hhi        ALS----------VTMTY--------IVLALCLSLVGVGLLRVTERTTVAYLVIGAGT--
2329|gene|hwa      ALSPIVIIEPWTLITSTYAHGSIGHLMSNLIALILFGALVERTTTRLRFHTFFILTGALA
1458|gene|hut      ALAWPLSENPWTLVTSVFVHRRIMHLVPNALFLFVIGIILERRTEPWRFYAFFVVVGVIA
34800|hp|hbo       ALAPPVLAPPWTLVTSVYAHVGPGHLLSNAVIVLLAGTLVSMSTTRLRFHAFFVGTGALA
158|gene|hla       ALSTPLSVAPWTVVTSVYAHGSIGHLLANALALLLVGPLVERRTTRLRFHAFVIGTGALA
3724|gene|nph      ALALPLSSQPWTLVVSVYAHGGLTHLLANAVALVLIGPLVARVTTPARFHAFFIITGALA
3058|gene|hhi      ALSPPLFSRPWTLVTSVYAHAGLSHLLANAVGLALAGVVLERRTSPLRFHAFFVSTGALA
12647|hp|hma       ALSPPLFSRPWTLVTSVYAHAGLSHLIANAVGVALAGVVLERRTSPLRFHAFFLSTGALA
                   **:          :. .:        :   : : : *  :   *    .  :.: .*.  

2560|hp|hhi        ----------------------GIYLVESAQF-LFGPQL--------------RFNADGR
2329|gene|hwa      GVAEITLGSLLAFSPR------AVLGASGAVFALFGYLITSNAIADTLIDTIDRVTDISW
1458|gene|hut      GVLEVTVGQVLGGPV-------AVLGASGAVFGLLGYILSGNPITDAV---ADRISVDPR
34800|hp|hbo       GLAHVWLAGLFGVPS-------AVLGSSGAAFALVGYVLAANPASSAI---LDRLRLSSR
158|gene|hla       GITQVTLGGLLGPQT-------AVLGLSGAVFGLGGYLLASNVVSATL---FDRLRLSTR
3724|gene|nph      GIAQVLVLMPFGGG--------AVLGASGAIFALFGYLLVGNRGTGRL---LSVVALGTR
3058|gene|hhi      GVSQVSITSLVGPLVPGMVSHVSVLGASGAVFALFGYLLAANRLTDTV---IGGFELAPR
12647|hp|hma       GVSQVSIASLVGPLVPGMVSHVSVLGASGAVFALFGYLLAANRLTDTV---IGGFELAPR
                                         .:   ..* * * *  :               .    .

2560|hp|hhi        VVLFLTGCL-------------------------IIAGAAGLHRRR--------------
2329|gene|hwa      AVTAVLIIVAAVMAILLSGPGTALVGHAAGLAIGLVAGRMRLLRIDNSSSTSAQRSV---
1458|gene|hut      VAILVMIGVALAITWLTRGRQVALVAHFTGLVLGLLAGRAHVLRAEQSTRSPPRGGRRGQ
34800|hp|hbo       AVIAIVAIVALVLTVLFSAPGSALIAHFTGAVMGLIAGRLQLL-----------------
158|gene|hla       AQFALFGLAALVLTATTAAPGVALIAHATGAFCGLVTGRAGLLDVQ--------------
3724|gene|nph      GKLVVLAVLAALLTAATATPGAALVAHFVGFVLGAAAGGSRLLHTSGSAG----------
3058|gene|hhi      VQLALAGIVAAAITLATANPGVALIAHFTGLLLGFLAGRVHLLRPTDSSQMPEAANY---
12647|hp|hma       VQLALAGGVAAAITLATANPGVALIAHFTGLLLGFLAGRVHLLRPTDSPQTPETANY---
                       :                               :*   :                  

2560|hp|hhi        -
2329|gene|hwa      -
1458|gene|hut      F
34800|hp|hbo       -
158|gene|hla       -
3724|gene|nph      -
3058|gene|hhi      -
12647|hp|hma       -