HOG Organism Gene ID Name Annotation
aHOG1370 hbo HBOR11770 Hbor_11770 hypothetical protein
aHOG1370 hla HLAC1695 Hlac_1695 hypothetical protein
aHOG1370 hut HUTA1857 Huta_1857 conserved hypothetical protein
aHOG1370 hwa HQ2789 hypothetical protein
aHOG1370 nph NP3756 hypothetical protein
aHOG1370 nrc1 VNG1453 vng1453 no entry
MUSCLE (3.6) multiple sequence alignment


1857|chp|hut      --------MVE---------------------VTYHCPYCGAVTSIDRAPSLQDASVTRH
1453|hp|nrc1      MVRVGSGKCFPESLPVPTRAFRLAPQPTGMVAVSYYCPRCGAVAELDRDAYLADKSVTPF
2789|hp|hwa       -------MSYP---------------------VTYYCPHCGAVVEVEREGYLADKSVTPY
11770|hp|hbo      -------MSYP---------------------VSYYCPHCGAVVELQREGYLADKSVTPY
1695|hp|hla       -------MSYP---------------------VTYYCPHCGTLVELERDGYLADKSVTPY
3756|hp|nph       --------MPA---------------------VSYYCPRCETTVELQRDGYLADKSVTPY
                                                  *:*:** * : ..::*   * * *** .

1857|chp|hut      PLADHEYAATTA----DVEA--GDGIEFVCLGDVGGE--------ATATGNAR-------
1453|hp|nrc1      PLAGWTYATPSD----DYEADEWDGVALSC-----GD--------ADHDGLDW-------
2789|hp|hwa       PLEGWIYTDPHDSTNVSYES--ADGIRFVC-----GEIPSELDTDQATSGIRW-------
11770|hp|hbo      PLVGWEYTDPGD----DFES--ADGINFVC-----GE--------SAAAGLRW-------
1695|hp|hla       PLEGWTYVDPTE----PFEGDDADGVRFVC-----GE----------SDGVDWDPHDGVR
3756|hp|nph       PLDGWDYVTADE----DYDTPEADGVRFVC-----GE-----------------------
                  ** .. *. .        :    **: : *     *:                       

1857|chp|hut      ----SQSSTAGDRAGPRPGRDGCGRTFYLNYRQS----------PPPTVGPTR-------
1453|hp|nrc1      ----THPPHEADSHDD---TPGCGEAVYLNFVRF---EDGQEVDGTQESQPVTLADSLEP
2789|hp|hwa       ----TGDRSPADDVENPDITSPCGRPFYLSFVRF---EDGTEIEPRPDTDRVRIASD--T
11770|hp|hbo      ----TGDQSEADDVENPMLDVPCGRDFYLSFVRF---EDGHEVEPVPETEYVDIGL----
1695|hp|hla       GPDVSETSDEGETSGEPRDAPSCGEPFYLSFVRY---EEGREIDPRAESELVEIDPDPRP
3756|hp|nph       -----------DDATRDPGAAGCGEPFYLSFVKHGTTPAGAALDSR--------------
                             :          **  .**.: .                           

1857|chp|hut      ------------------------
1453|hp|nrc1      TGPRGPTGP-------GFSR----
2789|hp|hwa       AGPSQPNGPTSPDGPGGFRR----
11770|hp|hbo      ------------------------
1695|hp|hla       SGPRGPSGPPGPDGGGGGSGGGFW
3756|hp|nph       ------------------------