HOG Organism Gene ID Name Annotation
aHOG1361 hhi 183 HAH_0183 hypothetical protein
aHOG1361 hbo HBOR01300 Hbor_01300 hypothetical protein
aHOG1361 hla HLAC0012 Hlac_12 hypothetical protein
aHOG1361 hmu HMUK1114 Hmuk_1114 conserved hypothetical protein
aHOG1361 hwa HQ3440 hypothetical protein
aHOG1361 nph NP0720 hypothetical protein
aHOG1361 hma Hma_12919 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


12|hp|hla         -----------------MRLNGVDDRLERHQYPTTSEELIAAHGNATVELADGSERLGDV
1300|hp|hbo       -----------------MRLNRTDELINAHEFPATTEELIEAYGDQTIEHPNGSEQLGDV
3440|hp|hwa       -------------MIDTMRLNHADDLINRHEFPATTEDIVEAHGEETIELPNGTTQLGEV
720|hp|nph        MYHTKSSLRILYIRVGMRLLANVEERIDAHSYPATTEELVEEYGDLELELPNGEETFGDA
183|hp|hhi        ------------------MLSNATDAFQSYDYPVSAEEIIEGDGDMELELPNGTERLGDA
12919|hp|hma      ----------------MRMLSNATDAFQSYDYPVSAEEIIEGDGDMELELPNGTERLGDA
                                     *  . : :: :.:*.::*:::   *:  :* .:*   :*:.

12|hp|hla         LERFGDQTFDNADDVFTTLRAGVCHRGVGRRFYSDRDPTTDADDGPSPVSF
1300|hp|hbo       FARAGFETYTCADDARNALLCGLGHEAIGRRYYSDRDVSTFGEDGPQQVSF
3440|hp|hwa       LTRAGSETYTCASDVQSALFCGLGSEAIGRRYYSDRDAYTTGEDGPQQVSF
720|hp|nph        LGRLGETTFEDAEDARLAAYSAVSSNAIGRQNYSDRDAPSIGENGPEQVSF
183|hp|hhi        LSRSAPETFESAEDAEFAAFAGVSSKAIGRKGYSDRDPVCMGEDGPDQVSF
12919|hp|hma      LSRSAPETFESAEDAEFAAFSGVSSKAIGRKGYSDRDPICMGEDGPDEVSF
                  : * .  *:  *.*.  :  ..:   .:**. *****    .::**. ***