HOG Organism Gene ID Name Annotation
aHOG1350 hhi 1573 HAH_1573 putative sugar transporter
aHOG1350 hhi 5103 HAH_5103 hypothetical protein
aHOG1350 hbo HBOR13890 Hbor_13890 sugar phosphate permease
aHOG1350 hla HLAC0358 Hlac_358 major facilitator superfamily MFS_1
aHOG1350 hmu HMUK0290 Hmuk_0290 major facilitator superfamily MFS_1
aHOG1350 hwa HQ1986 major facilitator superfamily transporter
aHOG1350 nph NP3610 tp22 major facilitator transporter
aHOG1350 hma Hma_10944 putative sugar transporter
MUSCLE (3.6) multiple sequence alignment


5103|hp|hhi         ----------------MNQTAILHAAFGVL---IVAGFLVSAP-----------------
1986|gene|hwa       ----------------MNGSDWSVVKFTMVGHALFHAYELSIPVFIIIWLDIFT------
358|gene|hla        ----------------MDSAEQRIVAFTAGSHGLVHTYELSIPILLTVWVGEFS------
3610|gene|nph       --------------MELASNDRSIAAFTMLGHGVVHWFELAIPILLVVWLDAFD------
13890|gene|hbo      ----------------MNRNDRSIVALVMLAHGMVHTYELSLPIFVTIWLMEFDVVNLGL
1573|gene|hhi       ----------------MNANDRAITALVMLAHGLVHTYEMAVPIFVVIWLTEFDLINLGI
10944|gene|hma      MRETVTHLPAADTNHTVNANDRAITALVMLAHGLVHTYEMAVPIFVVIWLTEFDLINLGI
                                    :       . :      :.  : :: *                 

5103|hp|hhi         ---------------LSYGLYGLGA-----------------ACFIA-------------
1986|gene|hwa       ----TTEAFLGLIVGVGYAAIGIGAVPSGILSDKYGSNRVVIVALLGMGFGFGLISISPN
358|gene|hla        ----TTAAVLGLVVTVGYGLFGVGALPGGILVDRFGSKPLILACLGGMAGSFLLVSLAPN
3610|gene|nph       ----VSVAVIGLVVALGYAPFGLGALPAGVLVDRFGPKQPILWCLTGMSLSFAALAVAPS
13890|gene|hbo      TQLDVTAATLGWVVTAGYGLFGIGALPGGVLVDRIGSRRLISLCLFGMAGSFVLLGLSPN
1573|gene|hhi       AQFDVTTATVGVIVTLGYGLFGAGALPGGIVVDRIGSRRLITGCLLGMGGSYILLGLAPS
10944|gene|hma      AQFNVTTATVGVIVTLGYGLFGAGALPGGIVVDRIGSRRLITGCLLGMGGSYILLGLAPS
                                    .*.  * **                  .: .             

5103|hp|hhi         ---------------------GILLARRDSD-----------------------------
1986|gene|hwa       IVVLALALAIWGISASLYHPAGLSLLSRRIENRSTAFAYHGVAGNVGTVLGPLLTSILLI
358|gene|hla        LLTLALAIAVWGVTASVYHPAGLSLLSKSVDQRGTALGYHGIGGNLGIALGPLATALLLL
3610|gene|nph       IYAVALCLLAWGIAASVYHPAGLALISTGVEDRGTVFAWHGIAGNLGIALGPFATATLLL
13890|gene|hbo      LVVVTLALLCWGAAASVYHPAGLALISKGMNERGTGFAYHGIAGNVGIGLGPLLTAILLV
1573|gene|hhi       MVVIALALVLWGLSASVYHPAGLSLISKGVEQRGTGLAYHGVAGNLGIGLGPLVAAILLL
10944|gene|hma      MVVIALALVLWGLSASVYHPAGLSLISKGVEQRGTGLAYHGVAGNLGIGLGPLVAAVLLL
                                         *: *     :                             

5103|hp|hhi         ------------------------------------------------------------
1986|gene|hwa       FLPWRSVAALSVIPTLVGISIAFKLPLGEK-----KAVEKK---------KNGTAVYREL
358|gene|hla        AFDWRIVTAALTVPAAVVAAYGLTVDIDDALPDTENAVSDGDIDGDGGSGANGAASLSTI
3610|gene|nph       FFEWQLVALALAVPGVVATAYGLSADFDST-----AAVDDT--PD-----DAGGSGRSSL
13890|gene|hbo      FLDWTTVAMLLAVPALVAGAYATRAKFDES-----AAVDAG--AGGSSKADAGVGSFAEF
1573|gene|hhi       VAEWRTVALVLGVPALLAAVYASRASFDET-----AAVTTA--TDGGSKASSGIDSLGEF
10944|gene|hma      VAEWRTVALVLGVPALLAAVYASQASFDET-----AAVTAA--TDGGSKASSGIDSLGEF
                                                                                

5103|hp|hhi         ------------------------------------------------------------
1986|gene|hwa       YEDTQILVVSGFPIIIAAVLLYGLYYRGTLTFLPQILLDAPMFNQITL------------
358|gene|hla        ADDTRVLLAGGFLIVFVFVTFSGLYYRTFLTFLPDLLGDV--LGGLIDIQLIDP------
3610|gene|nph       VSDSKSLFASSFLLVFSIVTIVGLYYRGVLTYLPEILQGLPAMAGVA----LPA------
13890|gene|hbo      VTESKRLIAGGLAVVFLVVICSGLFYRGVLTFLPDLLSGLDTFDPIPLASLLPAGLADAL
1573|gene|hhi       LTESKHLLTGSFLLVFVVVMCSGLYYRGVLTFLPELLRDLPGFEPIPIETLLPPSVLSAL
10944|gene|hma      LTESKHLLTGSFLLVFVVVMCSGLYYRGVLTFLPELLRGLPGFEPIPIETLLPPGVLSAL
                                                                                

5103|hp|hhi         ------------------------------GSETADSV----------------------
1986|gene|hwa       -----FGYTLNPTQYIYTALLTAGVGGQYAGGRLTDVVKAEYALILAFVLLVICALAFVP
358|gene|hla        --ESPYAEEFDVARYLYVAVLMVGVLGQYLGGRIADRVPPERALMVLMGILTVLALLFVP
3610|gene|nph       GI-----EELSLGDYFYVGLLVAGMAGQYVAGKLTRRMPVARGLVVVFGALAVLAVVFIP
13890|gene|hbo      GVEAGSGRMLKPERYFYSGLLMVGVLGQYAGGKLTDRLPVEWGLVGAFGALAVLAVLFLP
1573|gene|hhi       GIEAGTGQTLKPQDYFYAGLLLIGVFGQYAGGKLSDRIPVEYGIAGSFLVLAVLAVLFVP
10944|gene|hma      GIEVGTGQTLKPQDYFYAGLLLIGVLGQYAGGKLSDRIPVEYGIAGSFLVLAVLAVLFVP
                                                  ..  :  :                      

5103|hp|hhi         ------------------------------------------------------------
1986|gene|hwa       ILTTGFISLIIMCILIGFVIYLTAPIYQTVIAEHAANGTHGLSYGYTYLGMFGIGALGAP
358|gene|hla        ASET-IVTFIAVSLLLGVVLFTVQPLSQATVAAYSPSEARGISFGYTYLGIFGFGSLGAA
3610|gene|nph       VSGLGLVAVLVYCAVLGFTLFAIEPFYQEAVAVYTPADSRGLSYGYTYLGMFGLGALNIS
13890|gene|hbo      VVNAGLAPLLVFGAILGFFLFVIQPFYQATVAEYTPAGTRGLSYGYTYLGVFGVGALGGA
1573|gene|hhi       VSAMGFGPLAVLGALLGVALFVVQPMYQAAVAEYTPAGTRGLSYGYTYLGVFGVGALGGG
10944|gene|hma      VSAMGFGPLAVLGALLGIALFVVQPMYQAAVAEYTPAGTRGLSYGFTYLGVFGVGALGGG
                                                                                

5103|hp|hhi         ------------------------------------------------------
1986|gene|hwa       LAGTALSYMSTRVLFLALAGIAGLAGMVSIYLLV-----WKQD-----------
358|gene|hla        LAGTVLTRAGPRELFFVLAGIAALGALSAAGV-------SRLATRQD-------
3610|gene|nph       FGGFLLEYLSLTAFFLSLSVIAVAGTAVAWRLITAPVGQAAPAAEADAASSDDD
13890|gene|hbo      LAGTILTYATPTALFTTLAGIAVAGALFGFYL-------ARKNGAATGSEVTSD
1573|gene|hhi       LAGSILAFANATALFGTLAGIALVAVLAGTAL-------ARRS-----------
10944|gene|hma      LAGSILAFANATALFGTLAGIALVAAVTGVAL-------ARRK-----------