HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0134COG0596KOG4840 KOG2382 KOG2564 KOG2624 KOG4409arCOG01653Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily)hypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0134 nrc1 VNG0675 vng675 no entry
cHOG0134 nrc1 VNG6296d vng6296 no entry
cHOG0134 hmu HMUK2807 Hmuk_2807 alpha/beta hydrolase fold
cHOG0134 hma RRNAC0931 hypothetical protein
cHOG0134 hwa HQ1555A hydrolase
cHOG0134 hla HLAC0512 Hlac_512 alpha/beta hydrolase fold protein
cHOG0134 hbo HBOR23850 Hbor_23850 predicted hydrolase or acyltransferase of alpha/beta superfamily
cHOG0134 hut HUTA2969 Huta_2969 alpha/beta hydrolase fold
cHOG0134 hvo HVO_0832 HVO_0832 predicted hydrolase or acyltransferase
cHOG0134 nph NP2714A homolog to hydrolase
cHOG0134 hhi 1564 HAH_1564 alpha/beta hydrolase fold protein
MUSCLE (3.6) multiple sequence alignment


2714|gene|nph      ---------MAPKHLVRNAAVGLGAVVVGNRLLRCSPETLAP-PLARTQQTYEWQHRDVA
675|chp|nrc1       ---------MTLRRLLAGVAGGTAATAAANRLV--RADEQPPDPLPGTRTTTRWRGFDVS
6296|chp|nrc1      ----MRRWGMKLRQIAGSLAAATGVVAATNAALAWRADELAS-PLDGTNNTYQWRGFDIA
1555|gene|hwa      ---------MRVRSALGALAAGVGGLSGINAVLNRYVDSIDP-ALSGEHNTLTWSGIDIS
512|gene|hla       ---------MKLRNLAGTALLGVGAIAALNTGL-RYEGELES-PLDGDDGTFRWRGMNVA
23850|hp|hbo       ---------MKLRNVVGGVVAGTGLLAAANAVLSRRTPPLEP-ALSGEQHTYRWRGMDVH
2969|gene|hut      MPATPLVLDMKLRNLLTTAVGTAGVIAGVNRILTTRAGDLEA-PLVGSEGTYRWRGFDVA
10931|hp|hma       ---------MKLRKALGAVVGAVGATAAANRVLQSRAGAFEP-MLDGEQGTYRWRGFDIA
1564|gene|hhi      ---------MRLRKALGAVVGAVGATAAANRVLQSRAGAFEP-MLDGEQGTYRWRGFDIA
                            *  .          .     *  :        .  *     *  *   :: 

2714|gene|nph      YTEAGDPDAPDLVLLHAPELPRSSHEFRYVIDALSETHHVFAPDLPGFGRSAQLPETYDA
675|chp|nrc1       YTTAGDPDDPDLVLLHGVHAAASSRAFAGVVDTLAEDYHVLAPDLPGFGHTDRPSIAYTS
6296|chp|nrc1      YTEAGDPDDQDVVLLHGLNAAGSSFEFRNVFDALAADHHVIAPDLPGFGRSDRPPIEYAA
1555|gene|hwa      YTEAGDPTDHTLVLLHGINAAGSNGEFRRIFTALAESYHVVAPDLPGFGTSDRPPLRYSD
512|gene|hla       YTEAGDPDDPDLVLLHGVNAAGSAGEWREVFDDLAAEHHVFAPDLPGFGRSDRPPLRYSA
23850|hp|hbo       YTEAGDEDDPNLLLLHGVNAAASNGEFREVFDELAEDYHVIAPDLPGFGMSDRPPLRYSA
2969|gene|hut      YTEAGDPSDPDLLLVHGISAASSSREFAEVFEDLSREYHVIAPDLPGFGRSDRPPLLYSG
10931|hp|hma       YTEAGDPSDPDLVLFHGINAAASSHEFHTVFDTLAEDYHVIAPDLPGFGHTDRPPLLYSA
1564|gene|hhi      YTEAGDPSDPDLVLCHGINAAASNHEFHTVFDTLAEDYHVIAPDLPGFGHTDRPPLLYSA
                   ** ***     ::* *.   . *   :  :.  *:  :**.******** : . .  *  

2714|gene|nph      EGYSGFLQSFLS-DMTEQPTVVAASVTAAYAVAAGTDANA---ATDIDEYVLICPTTTAP
675|chp|nrc1       ALYEAFVASFIG-DVADDPAVVASSLTGAWAAMAAA-------DTSVSALALVCPIADTG
6296|chp|nrc1      SHYTTFVADFLA-DAAEDPMVVASSHSGAYATAAAAD------TDSVSELVLVCPTTAGF
1555|gene|hwa      TFYEEFVQAFLSEDRFNSVSVVASSLTGAYLASIHEDI-----ETDIESVVLICPTEKGG
512|gene|hla       ALYEDFVRDFLA-D-FDEPAVVASSLSAAYAAAAVDEAGSTADGVEVRGFVGVCPTTVAG
23850|hp|hbo       ALYEDFIGEFVA-E-FDDPAVVASSLTASYLIAA---------DPDVSRLILVCPSERGG
2969|gene|hut      SLYETFLRDAIR-DLADEPTVVASSLSGAYAACGAS-------DAAVESLVLIAPTDTTM
10931|hp|hma       SLYTAFVRDFIE-DNTADATVVASSLTGAYAASAAQ-------EVNVEELVLICPTDTSM
1564|gene|hhi      SLYTAFVRDFIE-DNTTDATVVASSLTGAYAASAAQ-------EVDVKELVLICPTDSSM
                     *  *:   :  :   .  ***:* :.::                :     :.*     

2714|gene|nph      QTTRR--LAPAYSLPVAGEAFRNVTMSKPMLRYRFGTDGFAEPSAMTAEWLRYSWQASHR
675|chp|nrc1       Q--RRPAVRRLLRTPVVGTAVFNALVSRRGLRCFTNRHAFYQSANVPAGLLDYQHRTSHQ
6296|chp|nrc1      SG-TRPLVGALVRAPVVGTALFNVATSKRAIRYFNADHGYHDESVVTEDVVEYHWRTAHQ
1555|gene|hwa      PN-RIVALRELLRAPVIGTALFNLLTSKPSIRYFNADHGYYNIENVSETWMEYEWQTAHQ
512|gene|hla       PSPPKSWLRELIRAPLVGDALFNVIASKPSIRYFNADHGYDDPTNPSDEWTDYEWRTAHV
23850|hp|hbo       PE-PKEWLRELIRAPVIGEAVFNLIGSKPSIRYFNADHGYADPSRVSDEWIDYEWRTAHQ
2969|gene|hut      SETPRSWLRSVFRAPLVGSGLFNLLVSKPGIKHFHRDHGYADMDNLTDETLEYQWKSAHQ
10931|hp|hma       GN-RTVWLRSLLRAPVIGEGIYNLTVSKASIRHFHADHGYYDMDNLTEDVVDYEWQSGHQ
1564|gene|hhi      GN-RTVWLRSLLRAPVIGEAIYNLTVSKPSIRHFHADHGYYDMDNLTEDVVDYEWQSGHQ
                          :      *: * .. *   *.  :.      .: :    .     * ..:.* 

2714|gene|nph      QGGHRLLAARAAGRLDSDIDLGSVLSETATTTTLLWGREADSPPVAAGRRLATAADARLV
675|chp|nrc1       PNARLAPASFAGGMLDPAVDLVDAVQSVPAPVTLVWGREARITPLADGRALADAADVRLT
6296|chp|nrc1      PGARFAAASFFAGALDVDMDLGAELAALDLPVTVVWGQEATISPVADGRDIADAAGARLV
1555|gene|hwa      PNARYAPASFISGFLNESEELKTTLSDIDVPVTLLWGREADITPLQRGRELAKDAGCRLV
512|gene|hla       ENARFAPASFVSGYLNSDLDLAAALASMDAAPTIVWGREADVSPLSDGRDLADASGARLV
23850|hp|hbo       QNARFAPASFISGYLNEDIDLETELADVDVPVTLVWGRDSDLVPLKRGRELAEAADCKLV
2969|gene|hut      PGARYAPASFVSGYLDPETELEDMLADVDAPVTLVWGRDAEITPVSAGRALAKKTDSRLV
10931|hp|hma       PGARFAPASFVSGFLDPEDDLGEVLAGLDVPVTMVWGEDADITPLSKGRDMAEQADAMLV
1564|gene|hhi      PGARFAPASFVSGFLDPEDDLGETLAGLDVPVTLVWGEDADITPLSEGRDLAEQADAMLV
                    ...   *:  .* *:   :*   :     . *::** ::   *:  ** :*  :.  *.

2714|gene|nph      VFENAATLPHAEHPEPFV-ELFDA-----------------
675|chp|nrc1       VLDDAGAVPHVEHPASFC-DALGAAL-----PQLEHH----
6296|chp|nrc1      VLEESDVQPHVERPEAFLRDAVEPSATVEGGEDVKHATDGA
1555|gene|hwa      VVDDAKLLPHVEFPDQCV-ETIQSAV------SRR------
512|gene|hla       VFDRAKLLPHVEHPERFV-ETVEESL------VASAAV---
23850|hp|hbo       VFDDTKLLPHVEFPEQFL-STVREDV------GIPA-----
2969|gene|hut      VFDDAKLLPHVEHPAAFV-GVVADDIDEAPSTAVSTA----
10931|hp|hma       VFGDSLLLPHVEHPGEFV-DVVRDRV-----TSVTVEN---
1564|gene|hhi      VFGDSLLLPHVEHPGEFV-DVVRDRV-----TSVTVEN---
                   *.  :   **.* *       .