HOG Organism Gene ID Name Annotation
aHOG1332 hhi 797 HAH_0797 hypothetical protein
aHOG1332 hbo HBOR13900 Hbor_13900 hypothetical protein
aHOG1332 hmu HMUK2786 Hmuk_2786 conserved hypothetical protein
aHOG1332 hut HUTA2508 Huta_2508 conserved hypothetical protein
aHOG1332 hwa HQ1804 hypothetical protein
aHOG1332 nph NP3800 hypothetical protein
aHOG1332 hma Hma_10037 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


2508|chp|hut      MIEYYDLVLGLIPLVLVSVAGGLTGAGIGHFTAMALASLVAIGLIAHGLFVRTPI-----
13900|hp|hbo      MTGYYDYVLGLIPMALLGLTGTLTVAGFGLTQAVPIAAGTAACIVGHALFINGPV-----
1804|hp|hwa       MTEYYDYVLGLIPLALFGLSGGLTELGLTLPQAVPLAAGVAAGIVGHALFINGPVSAALE
3800|hp|nph       MTGYYDIVLGLIPASLIGLTALFVFGGLSLSASVPLASVATIGLMGHAMFVNAPG-----
797|hp|hhi        MTGYYDIILGLIPLAMAGITASLFVVGFELTTAIPLASVVTVGLIGHAMFVRAPV-----
10037|hp|hma      MTGYYDIILGLIPLAMAGITASLFVVGFELTTAIPMASVVTVGLIGHAMFVRAPV-----
                  *  *** :*****  : .::. :   *:    ::.:*: .:  ::.*.:*:. *      

2508|chp|hut      -QTESEQAMRG---------------VAD
13900|hp|hbo      -STPTGNSLEADTSANAHSNPATPV-DAD
1804|hp|hwa       TQSDRSQSRSAESASAGHRNDNAPI-NAD
3800|hp|nph       -PSEPATSRPADSAA------QTGV-SAD
797|hp|hhi        -DPVPNDTSTQQSPQ------SDPLQTAD
10037|hp|hma      -DPVPSDTSA-QSAQ------SEPVQTAD
                    .    :                   **