HOG Organism Gene ID Name Annotation
aHOG1331 hhi 2198 aspS aspartyl-tRNA synthetase
aHOG1331 hbo HBOR25400 Hbor_25400 aspartyl-tRNA synthetase( EC:6.1.1.12 )
aHOG1331 hmu HMUK3044 Hmuk_3044 aspartyl-tRNA synthetase( EC:6.1.1.12 )
aHOG1331 hut HUTA2727 Huta_2727 aspartyl-tRNA synthetase
aHOG1331 hwa HQ1270 aspC aspartyl-tRNA synthetase
aHOG1331 nph NP1168 aspC aspartyl-tRNA synthetase
aHOG1331 hma Hma_11657 aspC aspartyl-tRNA synthetase
MUSCLE (3.6) multiple sequence alignment


1270|gene|hwa       MQDRTLTAEVTPGDEITVAGWVHEIRDLGGIAFLILRDRSGKIQIKFEKDEMNDEIVQTG
1168|gene|nph       MENRTYTADAEPGETVTVAGWVHEVRDLGGIAFLILRDTTGQIQVKFEKDEMDDELVETG
25400|gene|hbo      MQNRTYTADAEPGDSVTVAGWVHEVRDLGGIAFLILRDKSGKIQIKLEKDEMDEELVETG
2727|gene|hut       MQDRTYAADADPGTSATVAGWVHEIRDLGGIAFLILRDTTGKIQVKIEKDELDEALVETA
2198|gene|hhi       MENRTYTADATPGDTVTVAGWVHEIRDLGGIAFLILRDTTGKIQVKFEKDEMDDDLVETG
11657|gene|hma      MENRTYTADATPGDTVTVAGWVHEIRDLGGIAFLILRDTTGKIQVKFEKDEMDDDLVETG
                    *::** :*:. **   ********:************* :*:**:*:****::: :*:*.

1270|gene|hwa       LDVPRESVISITGVADDEPRAPTDVEIVPTAIEVLSSADTELPLDPSGKVNADLSTRLDN
1168|gene|nph       LNVARESVITVSGDVEEEPRAPTGVEVTPETVEVLSEADTELPLDPTGKVDAELSTRLDN
25400|gene|hbo      LDVARESVVSVSGDVKEEPRAPTGVEVVPEDIDVMAEADTQLPLDPSGKVDAELSTRLDN
2727|gene|hut       LDVHRESVLRVEGDVEEEERAPTGVEVTPDDIEVIAPADPELPLDPSGKVDAELPTRLDN
2198|gene|hhi       LNVQRESVISVTGDVEEEPRAPTGVEVTPESVDVISEADPELPLDPSGKVDAELPTRLDN
11657|gene|hma      LNVQRESVISVTGAVEEEPRAPTGVEVTPESVDVISEADPELPLDPSGKVDAELPTRLDN
                    *:* ****: : * ..:* ****.**:.*  ::*:: **.:*****:***:*:*.*****

1270|gene|hwa       RTLDLRKKEVKAVFQIRSEVLRAARDAFRELGCTEINTPKIVATGTEGGTELFPITYFGE
1168|gene|nph       RTLDLRSEEGQAIFEIRAEVLRAVREAFRDANATEINTSKIVATGTEGGTELFPITYFGE
25400|gene|hbo      RTLDLRKDEVKAVFEIRAEILRSVRDAFRGLNATEINTPKIVATGTEGGTELFPITYFGQ
2727|gene|hut       RTLDLRKPEVKAIFEIRAEVLRSVREAFRNLDATEINTPKIVATGTEGGTELFPITYFGR
2198|gene|hhi       RTLDLRKDEVKAIFEIRAEVLRSVREAFRDLNCTEINTPKIVATGTEGGTELFPITYFGQ
11657|gene|hma      RTLDLRKDEVKAIFEIRAEVLRSVREAFRELNCTEINTPKIVATGTEGGTELFPITYFGQ
                    ******. * :*:*:**:*:**:.*:***  ..*****.******************** 

1270|gene|hwa       EAFMNQSPQLFKQLMIGSGLERVFEIGPIFRAEEHNTPRHLNEATSIDFESAFINHAEAM
1168|gene|nph       EAFMNQSPQLFKQLVAGSNIERVFEIGPIFRAEEHNTPRHLNEATSIDFEGAFCDHTDAM
25400|gene|hbo      EAFMNQSPQLFKQLMVGSGLERVFEVGPIFRAEEHNTPRHLNEATSIDFESAFFDHTEAM
2727|gene|hut       EAFMNQSPQLFKQLMVGSGLERVFEIGPIFRAEEHNTPRHLNEATSIDFESAFYDHTEAM
2198|gene|hhi       EAFMNQSPQLFKQLMVGSGLERVFEIGPIFRAEEHNTPRHLNEATSIDFESAFYDHTEAM
11657|gene|hma      EAFMNQSPQLFKQLMVGSGLERVFEIGPIFRAEEHNTPRHLNEATSIDFESAFYDHTEAM
                    **************: **.:*****:************************.** :*::**

1270|gene|hwa       DACEYVVTAAYQGVAENCITELETLGLRDGFSVPDESFPRISYQEAIERINATGELDEQL
1168|gene|nph       DVCEQVVTAAYEAVAENCTDQLEALGITEEFEVPETPFPRLSYEEAIERINATGELDEQL
25400|gene|hbo      DACEHVVKAAYEGVAENCQRELETLGLAEEFEVPEGEFPRLTYEEAIERINATGELDEQL
2727|gene|hut       DACETVVKAAYEGVAGNCADELETLGLTEVFSAPEGDFPRLTYEEAIERINATGEIDDVL
2198|gene|hhi       DACEHVVRSAYEGVAENCQDELEALGLEDEFAAPEGDFPRLTYEDALDRINATGELDEPL
11657|gene|hma      DACEHVVQSAYEGVAENCQDQLEALGLEDEFAAPEGDFPRLTYEEALDKINATGELDEPL
                    *.** ** :**:.** **  :**:**: : * .*:  ***::*::*::.******:*: *

1270|gene|hwa       VWGDDLPTDGERALGADVGSHYFITDWPSEIKPFYIKDHDDDKTLSTGFDMMHPQMELVS
1168|gene|nph       VWGDDLPTEGEKALGDDVGGHYFITDWPAEIKPFYIMDHEDGE-LSTGFDMMHPRMELVS
25400|gene|hbo      VWGDDLPTEGERALGEDVGEHYFITDWPSEIKPFYIKDHDDDETLSTGFDMMHPRMELVS
2727|gene|hut       VWGDDLSTEAEHALGQDVGEHYFITDWPSEIKPFYIKDHDDDPELSTGFDMMHPSMELVS
2198|gene|hhi       VWGDDLSTEAEHVLGQEVGEHYFITDWPSEIKPFYIKDHDDDEEVSTGFDMMHPSMELVS
11657|gene|hma      VWGDDLSTEAEHVLGQEVGEHYFITDWPSEIKPFYIKDHDDDEEVSTGFDMMHPSMELVS
                    ******.*:.*..** :** ********:******* **:*.  :********* *****

1270|gene|hwa       GGQREHRYEHLVSGFEQQGLDPEQFDYYTKMFRYGMPPHAGWGLGGERLVMTMLGLENIR
1168|gene|nph       GGQREHRREELIAGFEQQGLEPEAFEYYTKMFKYGMPPHAGWGLGGERLLMTMLDLDNIR
25400|gene|hbo      GGQREHRFEHLVAGFEQQGLDPDQFEYYTKMFKYGMPPHAGWGLGGERLVMTMLGLDNIR
2727|gene|hut       GGQREHRHDHLVEGFEQQGLDPGAFEYYTKMFKYGMPPHAGWGLGGERLVMTMLGLENIR
2198|gene|hhi       GGQREHRFDHLVEGFEQQGLDPEAFEYYTKMFKYGMPPHAGWGLGGERLIMTMLGLENIR
11657|gene|hma      GGQREHRFDHLVEGFEQQGLDPEAFEYYTKMFKYGMPPHAGWGLGGERLIMTMLGLENIR
                    ******* : *: *******:*  *:******.****************:****.*:***

1270|gene|hwa       EAVLFPRDRQRLSP
1168|gene|nph       EAVLFPRDRQRLSP
25400|gene|hbo      EAVLFPRDRQRLSP
2727|gene|hut       EAVIFPRDRQRLSP
2198|gene|hhi       EAVLFPRDRQRLSP
11657|gene|hma      EAVLFPRDRQRLSP
                    ***:**********