HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0133COG1013arCOG01599Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases beta subunitpyruvate ferredoxin oxidoreductase.subunit beta

HOG Organism Gene ID Name Annotation
cHOG0133 nrc1 VNG0473 porB pyruvate ferredoxin oxidoreductase.subunit beta
cHOG0133 hmu HMUK3088 Hmuk_3088 pyruvate ferredoxin/flavodoxin oxidoreductase, beta subunit( EC:1.2.7.3 )
cHOG0133 hma RRNAC0719 porB 2-oxoglutarate ferredoxin oxidoreductase subunit beta
cHOG0133 hwa HQ1535A korB 2-oxoglutarate ferredoxin oxidoreductase subunit beta
cHOG0133 hla HLAC0927 Hlac_927 pyruvate ferredoxin/flavodoxin oxidoreductase, beta subunit
cHOG0133 hbo HBOR23340 Hbor_23340 2-oxoacid:acceptor oxidoreductase, beta subunit, pyruvate/2-ketoisovalerate family( EC:1.2.7.3 )
cHOG0133 hut HUTA0898 Huta_0898 pyruvate ferredoxin/flavodoxin oxidoreductase, beta subunit
cHOG0133 hvo HVO_0887 HVO_0887 porB 2-oxoglutarate ferredoxin oxidoreductase beta subunit
cHOG0133 nph NP1234A korB 2-oxoglutarate ferredoxin oxidoreductase subunit beta
cHOG0133 nph NP3012A 2-oxoglutarate ferredoxin oxidoreductase subunit beta
cHOG0133 hhi 1367 porB pyruvate ferredoxin/flavodoxin oxidoreductase subunit beta
MUSCLE (3.6) multiple sequence alignment


473|gene|nrc1       MSSENVRFTDFKSDKQPTWCPGCGDFGTMNGMMKALAETGNSPDDTFVVAGIGCSGKIGT
898|gene|hut        -MSSDTHFTDFKSDKQPTWCPGCGDFGTMNGMMKALAETGNDPDNTFVVAGIGCSGKIGT
10719|gene|hma      -MSSDVRFTDFKSDKQPTWCPGCGDFGTMNGMMKALAETGNDPDNTFIVAGIGCSGKIGT
1367|gene|hhi       -MSSDVRFTDFKSDKQPTWCPGCGDFGTMNGMMKALAETGNDPDNTFIVAGIGCSGKIGT
1234|gene|nph       -MSSNVRFTDFKSDKQPTWCPGCGDFGTMNGMMKALAETGNDPDNTFVVAGIGCSGKIGT
3012|gene|nph       -MSSNVRFTDFKSDKQPTWCPGCGDFGTMNGMMKALAETGNDPDNTFVVAGIGCSGKIGT
927|gene|hla        -MSSDIRFTDFKSDKQPTWCPGCGDFGTMNGMMKALAETGNDPDNTFVVAGIGCSGKIGT
1535|gene|hwa       -MSSDVRFTDFKSDKQPTWCPGCGDFGTMNGMMKALANTGNNPDNTFIVAGIGCSGKIGT
23340|gene|hbo      -MSSEIRFTDFKSDKQPTWCPGCGDFGTMNGMMKALANTGNDPDNTFVVAGIGCSGKIGT
                      *.: .******************************:***.**:**:************

473|gene|nrc1       YMRSYALHGVHGRALPVGTGVKLANPDLEVMVAGGDGDGYSIGAGHFIHAVRRNVDITYV
898|gene|hut        YMHSYALHGVHGRALPVGTGVKLANPDLEVMVAGGDGDGYSIGVGHFIHAVRRNIDITYV
10719|gene|hma      YMHSYALHGVHGRALPVGIGVKMANPDLEVMVSGGDGDGYSIGAGHFIHAVRRNVDMSYV
1367|gene|hhi       YMHSYALHGVHGRALPVGIGVKMANPDLEVMVSGGDGDGYSIGAGHFIHAVRRNVDMSYV
1234|gene|nph       YMHSYALHGVHGRALPVGTGVKMANPELEVMVAGGDGDGYSIGAGHFIHAVRRNVDMTYV
3012|gene|nph       YMHSYALHGVHGRALPVGTGVKMANPELEVMVAGGDGDGYSIGAGHFIHAVRRNVDMTYV
927|gene|hla        YMHSYALHGVHGRALPVGTGVKMARPDIEVMVAGGDGDGYSIGAGHFVHAVRRNVDMTYV
1535|gene|hwa       YMHSYALHGVHGRALPVGTGVKLANPELEVMVAGGDGDGYSIGAGHFVHAVRRNVDMSYI
23340|gene|hbo      YMHSYALHGVHGRALPVGAGVKLANPDLEVMVAGGDGDGYSIGAGHFVHAVRRNVDMTYV
                    **.*************** ***:*.*::****:**********.***:******:*::*:

473|gene|nrc1       VMDNRIYGLTKGQASPTSRSDFETSTSPDGPKQPPVNPLALAMAAGGSFIAQSFSSDALR
898|gene|hut        VMDNRIYGLTKGQASPTSRQGFETSTSPDGTVEPPVNPQALALAAGGTFIAQSFSSDSQR
10719|gene|hma      VMDNRIYGLTKGQASPTSREDFETSTSPDGPNQPPVNPKALALASGATFIAQSFSSNAQR
1367|gene|hhi       VMDNRIYGLTKGQASPTSREDFETSTSPDGPNQPPVNPKALALASGATFIAQSFSSNAQR
1234|gene|nph       VMDNRIYGLTKGQASPTSREDFETSTSPDGTNQQPVNPLALALAAGGTFIAQSFSSDSQR
3012|gene|nph       VMDNRIYGLTKGQASPTSREDFETSTSPDGTNQQPVNPLALALAAGGTFIAQSFSSDSQR
927|gene|hla        VMDNRIYGLTKGQASPTSREDFETSTSPEGPKQPPVNPHALALASGATFIAQSFSSDALR
1535|gene|hwa       VMDNRIYGLTKGQASPTSREDFETSTTPEGPQQPPVNPLALALASGGTFIAQSFSTDAQR
23340|gene|hbo      VMDNRIYGLTKGQASPTSREDFETSTTPEGPQQPPVNPMALALAAGATFIAQSFSTDARR
                    *******************..*****:*:*. : **** ***:*:*.:*******::: *

473|gene|nrc1       HQEIVQEAIEHDGFSLVNTFSPCVTFNDVDTYDYFRDSLVDLS-EDDDYDRHDYDQAKDA
898|gene|hut        HTELVKQAIEHDGFGFVNVYSPCVTFNDVDTYDYFRDAIVNL--DETDHDPTNYQSARDK
10719|gene|hma      HAEIVQKAVEHDGFGFVNVYSPCVTFNDVDTYDYFRDAIVDL--DETDHDPADRDQAKDK
1367|gene|hhi       HAEIVKQAVEHDGFGFVNVYSPCVTFNDVDTYDYFRDAIVDL--DETDHDPSDRDQAKDK
1234|gene|nph       HAELVQEAIEHDGFGFVNVYSPCVTFNDVDTYDYFRDAIVDVGDEDVDHDPSDYDEAKEL
3012|gene|nph       HAELVQEAIEHDGFGFVNVYSPCVTFNDVDTYDYFRDAIVDVGDEDVDHDPSDYDEAKEL
927|gene|hla        HQEIIQKAVEHDGFGFVNVYSPCVTFNDVDTYDYFRDSLVDL--KESDHDPSDKEAAKDV
1535|gene|hwa       HAEIVQKAIEHDGFGFVNVFSPCVTFNDVDTYDYFRDSLVDV--AESGHDPTDYDAAKGK
23340|gene|hbo      HAEIVQKAIEHDGFGFVNVFSPCVTFNDVDTYDYFRDSLVDL--AEEDHDPTDYDAAKEV
                    * *::::*:*****.:**.:*****************::*::   : .:*  : : *.  

473|gene|nrc1       ILDAGKEYLGVLYQDEDSTPYSEAHGVTENMAELPDGAPDGATDLVREFY
898|gene|hut        IMDPSTEHIGILYQNEESVPFSDREGIDANMADIPDGAPERADRLVREFY
10719|gene|hma      ILESEKEYMGVLYQDEDSVPFEEREGVEGSMAEIPDGAPEGAMDLVREFY
1367|gene|hhi       ILESEKEYMGVLYQDEDSVPFEEREGVEGSMAEIPDGAPEGAMDLVREFY
1234|gene|nph       ILDREKEYQGVLYQDESSVPFEVREGVDEPMVDIPDGAPEDATDLVREFY
3012|gene|nph       ILDREKEYQGVLYQDESSVPFEVREGVDEPMVDIPDGAPEDATDLVREFY
927|gene|hla        IFDDDTEHQGIIYQDEESVPYHERHGVDEDMSVIPDGAPEGATDLVREFY
1535|gene|hwa       ILDAEKEYQGVLWQNESAVAYDQKHSITQDMSAVDSGAPDGAMDLVREFY
23340|gene|hbo      ILDADKEFQGVVWQDEASVPYDEKHGVTENMSEIGEGAPEGAMDLVREFY
                    *::  .*. *:::*:* :..:    .:   *  : .***: *  ******