HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0132COG0377arCOG01554NADH:ubiquinone oxidoreductase 20 kD subunit and related Fe-S oxidoreductasesNADH dehydrogenase/oxidoreductase

HOG Organism Gene ID Name Annotation
cHOG0132 nrc1 VNG0636 ndhG1 NADH dehydrogenase/oxidoreductase
cHOG0132 hmu HMUK1918 Hmuk_1918 NADH-quinone oxidoreductase, B subunit( EC:1.6.5.3 )
cHOG0132 hma RRNAC1448 nuoB NADH dehydrogenase I B subunit
cHOG0132 hma PNG7189b ndhG1 NADH dehydrogenase/oxidoreductase
cHOG0132 hwa HQ1638A nuoB NADH dehydrogenase, subunit B (ubiquinone)
cHOG0132 hla HLAC0705 Hlac_705 NADH-quinone oxidoreductase, B subunit
cHOG0132 hbo HBOR21460 Hbor_21460 NADH dehydrogenase subunit B( EC:1.6.5.3 )
cHOG0132 hut HUTA0705 Huta_0705 NADH-quinone oxidoreductase, B subunit
cHOG0132 hvo HVO_0979 HVO_0979 ndhG nadh dehydrogenase/oxidoreductase
cHOG0132 nph NP2294A nuoB NADH dehydrogenase-like complex, subunit B
cHOG0132 hhi 2029 nuoB NADH dehydrogenase subunit B (ubiquinone)
cHOG0132 hhi 5362 ndh1 NADH dehydrogenase/oxidoreductase
MUSCLE (3.6) multiple sequence alignment


705|gene|hla        MSSDQ--PFITDESQVVTETRDSRMTGQG--DRFNSRLREAFGSSPFILTKFDKFLNWCR
705|gene|hut        MSQNTQQSESTGT----KSTREARM-GEGVDDRFNSRLREALGSTPFILTKFDQFMNWAR
636|gene|nrc1       MSSDQPRDSITDTSDPLTSTRDARM-GDGVDDRFNSRLREAFGSTPFILTKFDKFMNWVR
1638|gene|hwa       MSSEQDNAFVTDDTQVQTDTRDARI--SGTDERFNSKLREAFGSSPFILTKFDQFMNWVR
7189|gene|hma       MSSDRRN--VDD-----AQSDDRICPGRRANDRFNSTLREVLGSSPFILTKFDTFLNWVR
5362|gene|hhi       ----------------------------------------MLGSSPFILTKFDAFMNWVR
21460|gene|hbo      MSSDQNQPFVTDDTQVQTETRDARMTGSGADNRFNSKLREAFGSSPFILTKFDNFMNWVR
11448|gene|hma      MSSDQTPPAVED-----VSTQEARM-GDGADDRFNSTLREAFGSTPFILTKFDKFMNWVR
2029|gene|hhi       MSSDQTPPAVED-----VSTQEARM-GDGADDRFNSTLREAFGSTPFILTKFDKFMNWVR
2294|gene|nph       MSSEKLHDT--------TSTQQARM-GDGVDDRFNSKLREAFGSTPFILTKFDKFMNWVR
                                                             :**:******** *:** *

705|gene|hla        GSSMFMLQFGIACCSIEMMHTYAVKHDLDRFGSGVPRASPRQADVMIVPGTIVSKFAPRM
705|gene|hut        GSSMFMLQFGIACCSIEMMHTYSVKHDLDRFHAGVPRASPRQADVMIVPGTIVSKFAPRM
636|gene|nrc1       GSSMFMLQFGIACCSIEMMHTYSVKHDLDRFHAGVPRASPRQADVMIVPGTIVSKFAPRM
1638|gene|hwa       GSSMFMLQFGIACCSIEMMHTYAVKHDLDRFGAGVPRASPRQADVIIVPGTIVSKFAPRM
7189|gene|hma       GSSMFVLQFGIACCTIEMMGTLATKHDLDRFAAGVPRASPRQADLIIVPGTIVSKFAPRM
5362|gene|hhi       GSSMFVLQFGIACCTIEMMGTLATKHDLDRFAAGVPRASPRQADLIIVPGTIVSKFAPRM
21460|gene|hbo      GSSMFMLQFGIACCSIEMMHTYSVKHDLDRFAAGVPRASPRQADVIIVPGTIVSKFAPRM
11448|gene|hma      GSSMFMLQFGIACCSIEMIHTYAIKHDLDRFGSGVPRASPRQADVIIVPGTIVSKFAPRM
2029|gene|hhi       GSSMFMLQFGIACCSIEMIHTYAIKHDLDRFGSGVPRASPRQADVIIVPGTIVSKFAPRM
2294|gene|nph       GNSMFMLQFGIACCSIEMIHTYAIKHDLDRFGAGVPRASPRQADVIIVPGTIVSKFAPRM
                    *.***:********:***: * : ******* :***********::**************

705|gene|hla        KRVYDQMPEPKFVVGMGSCTISGGPFQEGYNVIKGAEEVIPIDIHVPGCPPRPEALVYGV
705|gene|hut        KRVYDQVPEPKFTIGMGSCTISGGPFQEGYNVVKGAEEVIPIDIQIPGCPPRPEALIYGV
636|gene|nrc1       KRVYDQMPEPKFVVNMGNCSTSGGPFQEGYNVVKGAEEVIPVDIHIPGCPPRPEALVYGV
1638|gene|hwa       KRVYDQMPEPKFVVGMGSCTVSGGPFQEGYNVIKGAEEVIPVDIHIPGCPPRPEALVYGI
7189|gene|hma       KRVYDQMPEPKFVVSMGSCTISGGPFQEGYNVIKGAEQVIPVDIHVPGCPPRPEALIYGI
5362|gene|hhi       KRVYDQMPEPKFVVSMGSCTISGGPFQEGYNVIKGAEQVIPVDIHVPGCPPRPEALIYGV
21460|gene|hbo      KRVYDQMPEPKFVVGMGSCTVSGGPFQEGYNVIKGAEEVIPVDIHVPGCPPRPEALIYGV
11448|gene|hma      KRVYDQMPEPKFVVSMGSCTISGGPFQEGYNVIKGAEEVIPVDIHVPGCPPRPEALIYGV
2029|gene|hhi       KRVYDQMPEPKFVVSMGSCTISGGPFQEGYNVIKGAEEVIPVDIHVPGCPPRPEALIYGV
2294|gene|nph       KRVYDQMPEPKFVVGMGSCTISGGPFQEGYNVIKGAEEVIPVDIHVPGCPPRPEALIYGI
                    ******:*****.:.**.*: ***********:****:***:**::**********:**:

705|gene|hla        VKLQERVANGEAAPVTVKPYELEEFSDLERDELVDKLADQVEDDELVMRYNFADSP
705|gene|hut        AKLQERIANGESSPVVVKPYELEEFGDLEQDEIVEKLADQIDEDDLVMRYNWADSP
636|gene|nrc1       AKLQERIANGESSPVTVKPYELEEFGDLERDEIVDKLAADIDEESLVMRYNWADSP
1638|gene|hwa       AKLQERISNGESAPVTVKPYELQQFDDLSQDEIVSQLAEEIDEDDLVMRYDWADSS
7189|gene|hma       AKLQERIAEGESSPVTVKPYELEQFGDLERDELVDKLASEIDEDDLVMRYDWS-SP
5362|gene|hhi       AKLQERIAEGESSPVTVKPYELEQFDDLERDELVDKLASKIDEDDLVMRYDWTGST
21460|gene|hbo      AKLQQRIAEGESSPVTVKPYELEQFGDLEQDELIDHLADQIDEEDLVMRYNWADSP
11448|gene|hma      AKLQERIAEGESSPVTVKPYELEQFGDLEQDELVDKLASEIDEEDLVMRYNWNDSP
2029|gene|hhi       AKLQERIAEGESSPVTVKPYELEQFGDLEQDELVDKLASEIDEEDLVMRYNWNDSP
2294|gene|nph       AKLQERIRNGETSPVTVKPYELEEFGDLERDELVQHLADQIDEEDLVMRYNWADSP
                    .***:*: :**::**.******::*.**..**::.:** .::::.*****::  *.