HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0131COG1252KOG2495arCOG01067NADH dehydrogenase FAD-containing subunitNADH dehydrogenase

HOG Organism Gene ID Name Annotation
cHOG0131 nrc1 VNG0891 yjlD NADH dehydrogenase
cHOG0131 hmu HMUK2736 Hmuk_2736 FAD-dependent pyridine nucleotide-disulphide oxidoreductase( EC:1.6.99.3 )
cHOG0131 hma RRNAC0450 yjlD1 NADH dehydrogenase
cHOG0131 hma RRNAC1301 yjlD2 NADH dehydrogenase
cHOG0131 hwa HQ2648A ndh NADH dehydrogenase
cHOG0131 hla HLAC0937 Hlac_937 FAD-dependent pyridine nucleotide-disulphide oxidoreductase
cHOG0131 hbo HBOR16450 Hbor_16450 NADH dehydrogenase, FAD-containing subunit( EC:1.6.99.3 )
cHOG0131 hut HUTA2772 Huta_2772 FAD-dependent pyridine nucleotide-disulphide oxidoreductase
cHOG0131 hvo HVO_1578 HVO_1578 nadh dehydrogenase
cHOG0131 nph NP3508A ndh NADH dehydrogenase
cHOG0131 hhi 1893 ndh3 NADH dehydrogenase
cHOG0131 hhi 1185 ndh2 NADH dehydrogenase
MUSCLE (3.6) multiple sequence alignment


891|gene|nrc1       MTTRVVVLGAGYAGAGAIAGLESEL-GP-DAELVWVADTDYHLVLHEAHRVIRDPGVQEK
2772|gene|hut       MTESVVVLGSGYAGAGAIQRLESEL-GD-RADLTWVSDQPYHLVLHEVHRCIRDPSVKEH
3508|gene|nph       MTDDVVVLGSGYAGTGAINSLESELDG--EADITWISDVDHHLVLHESHRCIRDPDIQEK
10450|gene|hma      MTENVVVLGSGYAGAGAIKSFEDELDGQTDVDVTWISETDYHLVLHESHRCIRDPSVQEN
11301|gene|hma      MTENVVVLGSGYAGAGAIKSFEDELDGQTDVDVTWISETDYHLVLHESHRCIRDPSVQEN
1893|gene|hhi       MTENVVVLGAGYAGAGAIKSLEDELDGVTDVDVTWISETDYHLVLHESHRCIRDPSVQEN
1185|gene|hhi       ----MVVLGAGYAGAGAIKSLEDELDGVTDVDVTWISETDYHLVLHESHRCIRDPSVQEN
937|gene|hla        MSTQVVVVGSGYAGAGAVKAFEDEV-GEGEADLTWISEHDYHLVLHEVHRAIRNPAVAEK
2648|gene|hwa       MSTQVVVVGAGYAGTGAVNRLEDKL-GS-ETELTWISEHDYHLVLHEVHRCIRDPSVESK
16450|gene|hbo      MSTQVVVLGSGYAGTGAVKRLEEEL-GP-DAELTWVSENDYHLVLHEVHRCIREPSAESN
                        :**:*:****:**:  :*.:: *   .::.*:::  :****** ** **:*   .:

891|gene|nrc1       ITIPVEDIKSRTTEFIEDSVTDIDTDERSVSLADGD-DVAYDYLVVGIGSETATYGIEGM
2772|gene|hut       VTIPVDEIKSPSTTFIEGRVETIDVEHRTVGFADGE-SIAYDHLLVAIGSQTAFFRIDGL
3508|gene|nph       ITFDVTEIKSPSTRFVQGRVEDIDTDERVITLDDDS-TVEYDYLLVGIGSQTAFFGIDGL
10450|gene|hma      IAIPVHEIKQPSTSFIQDEVVGIDTDAQEVDLADSD-TVEYDYLLVGLGSQTAFFGIEGL
11301|gene|hma      IAIPVHEIKQPSTSFIQDEVVGIDTDAQEVALADSD-TVEYDYLLVGLGSQTAFFGIEGL
1893|gene|hhi       ITIPVHEIKQPSTSFVQDEVVGIDTDAQEVALADSD-TVEYDYLLVGLGSQTAFFGIEGL
1185|gene|hhi       IAIPVHEIKQPSTSFVQDEVVGIDTDAQEVALADSD-TIEYDYLLVGLGSQTAFFGIDGL
937|gene|hla        ITIPVDEIKSPESNFVRGRVVDVDTNEQVVETDDGT-TVDYDYLLLGVGSTTAFFGIEGL
2648|gene|hwa       VAIPIDDIKTSETDFHTGRVTNVDVNDRTVEIDNGEETVGYDYLLLAIGSGTAFYNIDGL
16450|gene|hbo      VAIPIDEIKEPQTEFVKGHVENIDVEDRVVELEDGD--VEYDYLLVCLGSATAFYGIEGL
                    ::: : :**   : *  . *  :*.: . :   :.   : **:*:: :** ** : *:*:

891|gene|nrc1       AEHPLTLKSLDDAMEIHEQVREAAQDATRDDPANVVIGGAGLSGIQSAGEVAEFRDRHNA
2772|gene|hut       EENALTLKSLDDALAIHDAVESEADDATMADPARVVVGGAGQTGVQVAGEVAAYRAEMSA
3508|gene|nph       EEHSLTLKTLDDALEIHEAVSEAAREASRNDPAQVIVGGAGLSGIQSAGEIAEYRDSNRA
10450|gene|hma      KEHALTLKSLDDALEIHDKVQQAAREASTNDPAQVVIGGAGLSGIQTAGEVAEFRDEHNA
11301|gene|hma      KEHALTLKSLDDALEIHDKIQQAAREASTNDPAQVVIGGAGLSGIQTAGEVAEFRDEHNA
1893|gene|hhi       KEHALTLKSLDDALDIHDNIQQAARDASTNDPAQVVIGGAGLSGIQTAGEVAEFRDEHNA
1185|gene|hhi       EEHALTLKSLDDALDIHDNIQQAARDASTNDPAQVVIGGAGLSGIQTAGEVAEFRDEHNA
937|gene|hla        EENAHQLKSLADAKAIHEDVRSAAAEATRSDPVEVIVGGAGLSGIQTAGEIAEYRDKHRA
2648|gene|hwa       EEHAHELKGLNDARAIHSDVATAAKEATQEDPAQVIVGGAGLSGIQTAGEIAEYRDEHRA
16450|gene|hbo      QEFSHELKSLDDAREIHSDIKAAAEDASRDDPAKVIVGGAGLSGIQTAGEIAGYRDEHRA
                     * .  ** * **  **. :   * :*:  **. *::**** :*:* ***:* :*    *

891|gene|nrc1       PIDVTLVEALPEIFPPGDSEIQGALRHRLEDAGVTILTDDPITAASEDAIEFD-----ER
2772|gene|hut       PIDVVLVEGLESVLPGANSAFQSAIRDRLDKRSVDVQTGNFVSSVDDDAVYFD-----DG
3508|gene|nph       PLEIHLVEGLDNVFPNNDPVVQAKLRKLLEDKDVQIHTGEFIGEVDDDTVYVG-----DE
10450|gene|hma      PIDIHLVEGLDQVLPNSDPELQGALRKRLEAADVNIKCGEFIGEVDEETVYIG-----DE
11301|gene|hma      PIDIHLVEGLDQVLPNSDPELQGALRKRLEAADVNIKCGEFIGEVDEETVYIG-----DE
1893|gene|hhi       PIDIHLVEGLDQVLPNSDPELQGALRKRLEAADVNIKCGEFIGEVDEETVYIG-----DE
1185|gene|hhi       PIDIHLVEGLDQVLPNSDPELQGALRKRLEAADVNIKCGEFIGEVDEETVYIG-----DE
937|gene|hla        PVDIKLVEGLDEVFPGNDPQLQGALRQRLEDADIEILTGDFISKADEDAVYFGGGEDEEP
2648|gene|hwa       PMEITLVEGLDEVFPGNDTELQGALRERLEARDVRILTGEFISEVDSEMVYVGGNDDNDA
16450|gene|hbo      PIDITLVEGLDEVFPGNDPELQGALRKRLEARDVEILTGDFISKVDEENVYLGGGEDEDP
                    *::: ***.* .::*  :. .*. :*  *:  .: :  .: :  ...: : ..     : 

891|gene|nrc1       DSLDYDVFVWTGGVTGPSELSDVEMDAEH--NRLQASSTLQADDERVFAVGDCSMISQGN
2772|gene|hut       RDLAYDVLVWTGGITGQRAMEDVRVTKDHKSNRLKTTTTFQTDDERVFALGDAALVDQPG
3508|gene|nph       KELDYDVLLWTGGITGQDAAETANVDKDDRSNRIEAASNFQTSDERVFAIGDAALIDQPD
10450|gene|hma      DELDYDVLVWTGGITGRDCMQDVDLDKDERNHRVHAEGNFQTEDEHVFAIGDSALIDQPG
11301|gene|hma      DELEYDVLVWTGGITGRDCMQDVDLDKDERNHRVHAEGNFQTEDEHVFAIGDSALIDQPG
1893|gene|hhi       DELDYDVLVWTGGITGRDCMQDVDLDKDERNHRIHAEGNFQTEDEHVFAIGDSALIDQPG
1185|gene|hhi       DELDYDVLVWTGGITGRDCMQDVDLDKDERNHRVHAEGNFQTDDEHVFAIGDSALIDQPG
937|gene|hla        EELSYDVLIWTGGITGQPELENVEVEKDERSNRVHAGSDFTTSDDRVFAIGDTALVEQGD
2648|gene|hwa       EKLPYDTLVWTGGITGHNEVTDVGINKDDRSQRVFADADFQTSNERIFAVGDTALIEQGS
16450|gene|hbo      EELDYDVLIWTGGITGQEEVADADIEKDERSNRIFTDADFQTSDERVFAIGDSALIEQGT
                     .* **.::****:**      . :  :   :*: :   : :.::.:**:** :::.*  

891|gene|nrc1       -DDVAPPTAQAAWQAADVVARNVARAMEGRPLETWTYEDQGTLVSVGETAIAHDVEMSGI
2772|gene|hut       -EDPAPPNAQAAWQAADVAAENIARSIRGQPLTEWRYENKGTVVSVGDEAVATDV----L
3508|gene|nph       QDNPAPPTAQAAWQAAEVAGENIAREIRGQPLTEWEYEDKGTLISVGGKAVAHNV----K
10450|gene|hma      -DQPAPPTAQAAWQAAEVAGENLARAVRGQPLKTWTHKDKGTVVSVGEKAVAHDV----V
11301|gene|hma      -DQPAPPTAQAAWQAAEVAGENLARAVRGQPLKTWTHKDKGTVVSVGEKAVAHDV----V
1893|gene|hhi       -DQPAPPTAQAAWQAAEVAGENLARAVRGQPLKTWTHKDKGTVVSVGEKAVAHDV----V
1185|gene|hhi       -DQPAPPTAQAAWQAAEVAGENLARAVRGQPLKTWTHKDKGTVVSVGEKAVAHDV----V
937|gene|hla        -DDVAPPTAQAAWQAAEVAGENLARAARGAPLQSWEHTDKGTVVSVGEDAVAHDV----M
2648|gene|hwa       -ESVAPPTAQAAWQAAEVAGENVARAINEEPLQTWRHDDKGTVVSVGDDAVAHGVKFPVF
16450|gene|hbo      -DSVAPPTAQAAWQAAEVAGENVARTVRGQPLKTWTHNDKGTVVSIGDDAVAHAVKLPGL
                     :. ***.********:*.. *:**     **  * : ::**::*:*  *:*  *     

891|gene|nrc1       A-APIRTFGNMPAKVLKKGAAARWIAKITSWSRAMKAWDAL
2772|gene|hut       Y-SPIETFNGLGAELLKKVIAARWIADVSSFSRAFSAWPNM
3508|gene|nph       G-LPVDTFGGPAAKALKKTVAARWIAKVTGFSDAAKAFPDM
10450|gene|hma      N-MPIETFGGMPAKLLKKAIAARWINDMTGVGRAAKAWPDM
11301|gene|hma      N-MPIETFGGMPAKLLKKAIAARWINDMTGVGRAAKAWPDM
1893|gene|hhi       N-MPIETFGGMPAKLLKKAIAARWIKDVTGVGRAVKAWPDM
1185|gene|hhi       N-MPIETFGGMPAKLLKKAIAARWIKDVTGVGRAVKAWPDM
937|gene|hla        G-MPIKTFGGTPAKLLKKSIAVRWIAKISSTGRGVSAFGDM
2648|gene|hwa       GKLPINVFAGPAARTLKKGIAARWIADVASTRHALEAWESM
16450|gene|hbo      GKLPINVFGGPAARALKKGIAAKWISDVTDARRAVEAWDSL
                       *: .* .  *  ***  *..** .::.   . .*:  :