HOG Organism Gene ID Name Annotation
aHOG1307 hhi 3070 fdx6 ferredoxin
aHOG1307 hbo HBOR29340 Hbor_29340 ferredoxin
aHOG1307 hla HLAC1615 Hlac_1615 ferredoxin
aHOG1307 hmu HMUK0431 Hmuk_0431 ferredoxin
aHOG1307 hut HUTA0452 Huta_0452 heat shock protein DnaJ domain protein
aHOG1307 hwa HQ3171 fer1 DnaJ N-terminal domain-containing protein
aHOG1307 hma Hma_12662 fer ferredoxin
MUSCLE (3.6) multiple sequence alignment


3171|gene|hwa       MVLRSRYDRTFIAVYIFDILLVLQGGGCQQFINPTNQKEETNQSDHRAMIVVSVYDILGI
1615|gene|hla       --------------------------------------------------MVSPFDVLGL
452|gene|hut        --------------------------------------------------MPSPYQILEI
29340|gene|hbo      --------------------------------------------------MDSPFEILGI
3070|gene|hhi       --------------------------------------------------MESPFEVLGI
12662|gene|hma      ------------------------------------------------------------
                                                                                

3171|gene|hwa       TASANEETILQAYRTRVKEAHPDHGGSLAEFRQVRRAYEHIDSGAPAGEFESATGTNHHN
1615|gene|hla       DDDADEADVERAYRERVKEAHPDQGGTVEEFQLVRRAYRELGERD---------------
452|gene|hut        DRAASEDAIHRAYRRRVKEAHPDQGGSAAEFQAVQTAYEALLSEF---------------
29340|gene|hbo      EPDADDAEVDRAFRRRVIEVHPDQGGSAAEFNRVRSAYEMIKEGHPI------------E
3070|gene|hhi       PPDADDGEIVDAYRERVKEAHPDQGGSTEEFQAVKDAYERLQNGY---------------
12662|gene|hma      ------------------------------------------------------------
                                                                                

3171|gene|hwa       NTAQDADVESQSSSSSVSASADTTDKTETLGP-TVEYLDYRVLADYGWEITDPDLFAKAD
1615|gene|hla       ---RNGDADDETDPADIDLTDEAGEV-DAVQPVRVEFLDYEAIDDYGWSLDDDDLFRKAS
452|gene|hut        ----------------HEGSDDGARLDRSAGPVSVEYLDYDVLDDQGWTLDDGSLFGKAA
29340|gene|hbo      AVNGEVSGDTPSSSSSASVPDDGDEDEDELRS-KIEYLNYEVLDDHGWDLGDDDLFEKAA
3070|gene|hhi       ---EPGDPLPDESPTGEPGSETEQAPPEPDDP-LVEFLNFEVLEDHGWALEDEDLFEKAA
12662|gene|hma      ---------------------------------MVEFLNFEVLEDHGWALQDEDLFAKAA
                                                      :*:*:: .: * ** : * .** ** 

3171|gene|hwa       AVELDIDAHGIFVVEPRESLLEAAERYGFSWPYACRGGACANCAVAVIDGAVEMSVNTIL
1615|gene|hla       HADLDPAAHGRLLVHPDESLLEAAERSGFGWPFSCRGGACANCAVFLVEGELSQPADHIM
452|gene|hut        DAGLDATDYGTFSVTPERTLLESAEATGHEWPYSCRGGACANCAVAVCRGELSQPVNHIL
29340|gene|hbo      AANLPHEDYGQFLVQENETLLEAAENRGYAWPYACRGGACANCAVAVFEGEMDTPGDHIL
3070|gene|hhi       DANLRSSDFGRFYVDPNDTLLEAAEKNGFAWPFACRGGACTNCAVAVVDGEMPSPASHIL
12662|gene|hma      DANLQSTDFGRFYVDPNDTLLEAAEKNGFAWPFACRGGACTNCAVAVVDGEMPSPASHIL
                     . *    .* : *    :***:**  *. **::******:**** :  * :  . . *:

3171|gene|hwa       TQGMRDRGIRLSCIGQPVTNDLQVVFNIEQLPGLKELRLPAEQFENTRTDNSS
1615|gene|hla       PEELAERGFRLSCNGYPVSDELKVVFNVKQLAELDDLILPPGPFTRR------
452|gene|hut        PADAIDRGIRLSCVGKPITDDLAVVYNVKHLPSIADLRLPPRPADSRGID---
29340|gene|hbo      PSTMLDSDIRLSCMGAPLTDDMKVVFNVKHLPGLDELRLPPYPFEQAHMND--
3070|gene|hhi       PPDLTEKGIRLSCIAAPVSDDAKIVYNLKHLPEVSELLLPASRFEQASSTD--
12662|gene|hma      PPELTEKGIRLSCIAAPVSDDAKIVYNLKHLPEVSELLLPASRFEQASSTD--
                    .    : .:**** . *::::  :*:*:::*. : :* **.